ALG7/YBR243C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrII: 706788 to 705442
CDS: 706788 - 705442

Genetic Map Data

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

ALG7 YBR243C TUR1 ORF, Verified S000000447

Description
UDP-N-acetyl-glucosamine-1-P transferase, transfers Glc-Nac-P from UDP-GlcNac to Dol-P in the ER in the first step of the dolichol pathway of protein asparagine-linked glycosylation; inhibited by tunicamycin

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
UDP-N-acetylglucosamine-dolichyl-phosphate N-acetylglucosaminephosphotransferase activity Kukuruzinska MA and Robbins PW (1987) Protein glycosylation in yeast: transcript heterogeneity of the ALG7 gene. Proc Natl Acad Sci U S A 84(8):2145-9
     TAS : Traceable Author Statement
Assigned on 2001-01-18 SGD
GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.
     IEA : Inferred from Electronic Annotation with IUBMB:2.7.8.15
Assigned on 2007-05-23 UniProtKB
transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0808
Assigned on 2007-05-23 UniProtKB
transferase activity, transferring glycosyl groups GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0328
Assigned on 2007-05-23 UniProtKB
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
aerobic respiration Mendelsohn RD, et al. (2005) A hypomorphic allele of the first N-glycosylation gene, ALG7, causes mitochondrial defects in yeast. Biochim Biophys Acta 1723(1-3):33-44
       IMP : Inferred from Mutant Phenotype
Assigned on 2007-04-18 SGD
protein amino acid N-linked glycosylation Mendelsohn RD, et al. (2005) A hypomorphic allele of the first N-glycosylation gene, ALG7, causes mitochondrial defects in yeast. Biochim Biophys Acta 1723(1-3):33-44
       IMP : Inferred from Mutant Phenotype
Assigned on 2007-04-18 SGD
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
endoplasmic reticulum Burda P and Aebi M (1999) The dolichol pathway of N-linked glycosylation. Biochim Biophys Acta 1426(2):239-57
     IC : Inferred By Curator from protein amino acid N-linked glycosylation
Assigned on 2002-11-13 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23 UniProtKB
integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2009-01-12 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2008-02-14 UniProtKB

Pathways [TOP] [NEXT]
lipid-linked oligosaccharide biosynthesis

Summary Paragraph [TOP] [NEXT]
SUMMARY PARAGRAPH for ALG7/YBR243C for ALG7
During N-linked glycosylation of proteins, oligosaccharide chains are assembled on the carrier molecule dolichyl pyrophosphate in the following order: 2 molecules of N-acetylglucosamine (GlcNAc), 9 molecules of mannose, and 3 molecules of glucose. These 14-residue oligosaccharide cores are then transferred to asparagine residues on nascent polypeptide chains in the endoplasmic reticulum (ER). As proteins progress through the Golgi apparatus, the oligosaccharide cores are modified by trimming and extension to generate a diverse array of glycosylated proteins (reviewed in 1, 2).
ALG7 encodes the dolichyl-P-dependent N-acetylglucosamine-1-P transferase (GPT) that catalyzes the first step in the synthesis of lipid-linked oligosaccharides (LLO's): addition of the first N-acetylglucosamine to dolichyl phosphate on the cytosolic side of the endoplasmic reticulum (3, 4).

Alg7p is essential, and its activity is inhibited by tunicamycin (3, 5). Expression of ALG7 is cell-cycle regulated, in coordination with ALG1 and ALG2 (5, 6). Upon alpha factor arrest, mutants with diminished Alg7p activity show only transient downregulation of CLN1 and CLN2 mRNAs, and therefore these alg7 mutants resume their progression through the cell cycle (7). An interesting hypomorphic alg7 mutant lost mitochondrial DNA (8).

ALG7 is the most ancient and widely found of the ALG genes examined (9). An orthologous gene from an Archaeal species (Methanococcus voltae) complements the alg7 deletion (10). The human ortholog, DPAGT1 (OMIM), also complements a conditional deletion of ALG7 (11). Mutations in DPAGT1 cause the congenital disorder of glycosylation CDG-Ij (OMIM) (12).
Last Updated: 2008-03-18

Basic References [TOP]
BASIC INFORMATION REFERENCES forALG7/YBR243C for ALG7
1) Herscovics A and Orlean P (1993) Glycoprotein biosynthesis in yeast. FASEB J 7(6):540-50

2) Burda P and Aebi M (1999) The dolichol pathway of N-linked glycosylation. Biochim Biophys Acta 1426(2):239-57

3) Barnes G, et al. (1984) Asparagine-linked glycosylation in Saccharomyces cerevisiae: genetic analysis of an early step. Mol Cell Biol 4(11):2381-8

4) Kukuruzinska MA and Robbins PW (1987) Protein glycosylation in yeast: transcript heterogeneity of the ALG7 gene. Proc Natl Acad Sci U S A 84(8):2145-9

5) Kukuruzinska MA and Lennon K (1994) Growth-related coordinate regulation of the early N-glycosylation genes in yeast. Glycobiology 4(4):437-43

6) Pretel R, et al. (1995) Expression of the first N-glycosylation gene in the dolichol pathway, ALG7, is regulated at two major control points in the G1 phase of the Saccharomyces cerevisiae cell cycle. Exp Cell Res 219(2):477-86

7) Lennon K, et al. (1997) Deregulation of the first N-glycosylation gene, ALG7, perturbs the expression of G1 cyclins and cell cycle arrest in Saccharomyces cerevisiae. Biochem Biophys Res Commun 237(3):562-5

8) Mendelsohn RD, et al. (2005) A hypomorphic allele of the first N-glycosylation gene, ALG7, causes mitochondrial defects in yeast. Biochim Biophys Acta 1723(1-3):33-44

9) Samuelson J, et al. (2005) The diversity of dolichol-linked precursors to Asn-linked glycans likely results from secondary loss of sets of glycosyltransferases. Proc Natl Acad Sci U S A 102(5):1548-53

10) Shams-Eldin H, et al. (2008) Identification of the archaeal alg7 gene homolog (encoding N-acetylglucosamine-1-phosphate transferase) of the N-linked glycosylation system by cross-domain complementation in Saccharomyces cerevisiae. J Bacteriol 190(6):2217-20

11) Eckert V, et al. (1998) Cloning and functional expression of the human GlcNAc-1-P transferase, the enzyme for the committed step of the dolichol cycle, by heterologous complementation in Saccharomyces cerevisiae. Glycobiology 8(1):77-85

12) Wu X, et al. (2003) Deficiency of UDP-GlcNAc:Dolichol Phosphate N-Acetylglucosamine-1 Phosphate Transferase (DPAGT1) causes a novel congenital disorder of Glycosylation Type Ij. Hum Mutat 22(2):144-50

13) Kukuruzinska MA and Lennon K (1995) Diminished activity of the first N-glycosylation enzyme, dolichol-P-dependent N-acetylglucosamine-1-P transferase (GPT), gives rise to mutant phenotypes in yeast. Biochim Biophys Acta 1247(1):51-9

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for ALG7/YBR243C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for ALG7/YBR243C

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MLRLFSL

C-term DNLWTVR

Length(aa) 448

MW(Da) 50,367

pI 8.4

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.063

Codon Adaptation Index 0.133

Frequency of Optimal Codons 0.431

Hydropathicity of Protein 0.588

Aromaticity Score 0.129

10 20 30 40 50 | | | | | MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR*

Protein Structures from PDB: proteins of known structure with sequence similarity to ALG7/YBR243C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
ALG7 SGD (2007) Information without a citation in SGD

Mapping Notes
Date Note
1996-09-21 Edition 13: ALG7 was previously believed to be on chromosome VII
Cherry JM, et al. (1996) "Genetic and Physical Maps of Saccharomyces cerevisiae (Edition 13)". Pp. 361-364 in 1996 Yeast Genetics and Molecular Biology Meeting Program and Abstracts. Bethesda, MD: The Genetics Society of America

Standard Name	Reference
ALG7	SGD (2007) Information without a citation in SGD

Date	Note
1996-09-21	Edition 13: ALG7 was previously believed to be on chromosome VII *Cherry JM, et al.* (1996)** "Genetic and Physical Maps of Saccharomyces cerevisiae (Edition 13)". Pp. 361-364 in 1996 Yeast Genetics and Molecular Biology Meeting Program and Abstracts. Bethesda, MD: The Genetics Society of America

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YBR243C SGD Systematic Sequence

852545 NCBI: Gene ID

NP_009802.1 NCBI: RefSeq protein version ID

NP_009802.1 NCBI: RefSeq protein version ID

6319720 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YBR243C	SGD Systematic Sequence
852545	NCBI: Gene ID
NP_009802.1	NCBI: RefSeq protein version ID
NP_009802.1	NCBI: RefSeq protein version ID
6319720	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
40 curated references; 0 references not yet curated
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
He X, et al. (2010) Prevalent positive epistasis in Escherichia coli and Saccharomyces cerevisiae metabolic networks. Nat Genet
       |ACT1 |AVO1 |CCT2 |CHO2 |EOS1 |GAA1 |GAS1 |GUK1 |MET22 |NUP60 |NUS1 |RPC10 |RPL14A |RPS5 |MORE
Mutants/Phenotypes
Ammar R, et al. (2009) A comparative analysis of DNA barcode microarray feature size. BMC Genomics 10:471
       |ADO1 |BCK1 |COP1 |FYV8 |GET2 |HAC1 |IRE1 |PSE1 |RER2 |RET2 |RPC31 |VPS25 |YER010C |YFL032W |MORE
Strains/Constructs
Techniques and Reagents
Clark KM, et al. (2009) Purification of Transmembrane Proteins from Saccharomyces cerevisiae for X-ray Crystallography. Protein Expr Purif
       |AAC1 |AAC3 |ADP1 |ALG3 |BOR1 |CHO1 |DGA1 |DPP1 |ENA5 |EPT1 |GPT2 |LPP1 |NFT1 |PDR10 |MORE
Other Features
Smith AM, et al. (2009) Quantitative phenotyping via deep barcode sequencing. Genome Res 19(10):1836-42
       |ERG11 |ERG24 |SSL2
Genetic Interactions
Tan SX, et al. (2009) Cu, Zn superoxide dismutase and NADP(H) homeostasis are required for tolerance of endoplasmic reticulum stress in Saccharomyces cerevisiae. Mol Biol Cell 20(5):1493-508
       |AAT2 |ADO1 |AIM26 |ARO2 |BCK1 |BUR2 |CCS1 |CNB1 |CNM67 |CRZ1 |CSG2 |ELP2 |ERG2 |ERG6 |MORE
Mutants/Phenotypes
Strains/Constructs
Transcription
Yan Z, et al. (2009) Precise gene-dose alleles for chemical genetics. Genetics 182(2):623-6
       |DFR1 |IPP1 |RNR2
Mutants/Phenotypes
Strains/Constructs
Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8
       |AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALR1 |AOS1 |MORE
Fungal Related Genes/Proteins
Deshpande N, et al. (2008) Protein glycosylation pathways in filamentous fungi. Glycobiology 18(8):626-37
       |ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG6 |ALG8 |ALG9 |ANP1 |CWH41 |DIE2 |DPM1 |MORE
Reviews
Jigami Y (2008) Yeast glycobiology and its application. Biosci Biotechnol Biochem 72(3):637-48
       |ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG5 |ALG6 |ALG8 |ALG9 |ANP1 |CWH41 |DIE2 |MORE
Cross-species Expression
Genetic Interactions
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Strains/Constructs
Shams-Eldin H, et al. (2008) Identification of the archaeal alg7 gene homolog (encoding N-acetylglucosamine-1-phosphate transferase) of the N-linked glycosylation system by cross-domain complementation in Saccharomyces cerevisiae. J Bacteriol 190(6):2217-20

Regulation of
Transcription
van den Brink J, et al. (2008) New insights into the Saccharomyces cerevisiae fermentation switch: dynamic transcriptional response to anaerobicity and glucose-excess. BMC Genomics 9:100
       |ACE2 |ARE1 |AUS1 |BAS1 |DAL5 |DAN1 |DAN4 |DNF2 |FAA4 |FET4 |FHL1 |GCN4 |GLN3 |GNT1 |MORE
Protein Physical Properties
White MA, et al. (2007) Characteristics affecting expression and solubilization of yeast membrane proteins. J Mol Biol 365(3):621-36
         |ALG1 |APQ12 |AQY1 |ARE2 |ATG9 |ATP4 |BET1 |BIG1 |BOS1 |BRR6 |CAX4 |CHO1 |COS7 |COS8 |MORE
Reviews
Lehle L, et al. (2006) Protein glycosylation, conserved from yeast to man: a model organism helps elucidate congenital human diseases. Angew Chem Int Ed Engl 45(41):6802-18
       |ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG5 |ALG6 |ALG8 |ALG9 |DIE2 |DPM1 |OST1 |MORE
Reviews
Weerapana E and Imperiali B (2006) Asparagine-linked protein glycosylation: from eukaryotic to prokaryotic systems. Glycobiology 16(6):91R-101R
       |ALG1 |ALG11 |ALG13 |ALG14 |ALG2 |ALG9 |OST1 |OST2 |OST3 |OST4 |OST5 |OST6 |RFT1 |SEC11 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Davierwala AP, et al. (2005) The synthetic genetic interaction spectrum of essential genes. Nat Genet 37(10):1147-52
           |ABD1 |ACT1 |ALG13 |ALG14 |APC11 |ARL3 |ARP2 |ARP7 |ASK1 |AVO1 |BET3 |BET5 |BIM1 |BNI1 |MORE
Function/Process
Mutants/Phenotypes
RNA Levels and Processing
Regulatory Role
Strains/Constructs
Transcription
Mendelsohn RD, et al. (2005) A hypomorphic allele of the first N-glycosylation gene, ALG7, causes mitochondrial defects in yeast. Biochim Biophys Acta 1723(1-3):33-44
       |ALG3 |ALG5 |ALG6 |CHS1 |CNE1 |GPX2 |GSC2 |KAR2 |URA3 |YBR241C |YBR242W
Fungal Related Genes/Proteins
Non-Fungal Related Genes/Proteins
Samuelson J, et al. (2005) The diversity of dolichol-linked precursors to Asn-linked glycans likely results from secondary loss of sets of glycosyltransferases. Proc Natl Acad Sci U S A 102(5):1548-53
         |ALG1 |ALG11 |ALG2 |ALG5 |DPM1 |STT3
Reviews
Burda P and Aebi M (1999) The dolichol pathway of N-linked glycosylation. Biochim Biophys Acta 1426(2):239-57
     |ALG2
Mutants/Phenotypes
Strains/Constructs
Giaever G, et al. (1999) Genomic profiling of drug sensitivities via induced haploinsufficiency. Nat Genet 21(3):278-83
       |ERG11 |HIS3 |RNR2 |RPL20A |RSN1 |TUB1 |TUB2 |YMR007W
Reviews
Kukuruzinska MA and Lennon-Hopkins K (1999) ALG gene expression and cell cycle progression. Biochim Biophys Acta 1426(2):359-72
     |ALG2 |ALG3
Function/Process
Mutants/Phenotypes
Strains/Constructs
Mazhari-Tabrizi R, et al. (1999) Chromosomal promoter replacement in Saccharomyces cerevisiae: construction of conditional lethal strains for the cloning of glycosyltransferases from various organisms. Glycoconj J 16(11):673-9
     |ALG1 |DPM1 |GAA1 |GPI2 |PIS1 |SEC59 |SPT14 |WBP1
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Eckert V, et al. (1998) Cloning and functional expression of the human GlcNAc-1-P transferase, the enzyme for the committed step of the dolichol cycle, by heterologous complementation in Saccharomyces cerevisiae. Glycobiology 8(1):77-85

Function/Process
Genetic Interactions
Lennon K, et al. (1998) Molecular dissection of the genetic targets of ALG7 in the serpentine receptor-mediated signal transduction pathway in yeast. Ann N Y Acad Sci 842:195-8

Cell Cycle Phase Involved
Function/Process
Mutants/Phenotypes
Regulatory Role
Lennon K, et al. (1997) Deregulation of the first N-glycosylation gene, ALG7, perturbs the expression of G1 cyclins and cell cycle arrest in Saccharomyces cerevisiae. Biochem Biophys Res Commun 237(3):562-5
       |CLN1 |CLN2
Cell Cycle Phase Involved
RNA Levels and Processing
Lennon K, et al. (1997) The dual role of mRNA half-lives in the expression of the yeast ALG7 gene. Mol Cell Biochem 169(1-2):95-106

Function/Process
Mutants/Phenotypes
Kukuruzinska MA and Lennon K (1995) Diminished activity of the first N-glycosylation enzyme, dolichol-P-dependent N-acetylglucosamine-1-P transferase (GPT), gives rise to mutant phenotypes in yeast. Biochim Biophys Acta 1247(1):51-9

Cell Cycle Phase Involved
Lennon K, et al. (1995) Proliferation-dependent differential regulation of the dolichol pathway genes in Saccharomyces cerevisiae. Glycobiology 5(6):633-42
     |ALG1 |ALG2
Cell Cycle Phase Involved
Function/Process
Pretel R, et al. (1995) Expression of the first N-glycosylation gene in the dolichol pathway, ALG7, is regulated at two major control points in the G1 phase of the Saccharomyces cerevisiae cell cycle. Exp Cell Res 219(2):477-86

Fungal Related Genes/Proteins
Zou J, et al. (1995) Asparagine-linked glycosylation in Schizosaccharomyces pombe: functional conservation of the first step in oligosaccharide-lipid assembly. Arch Biochem Biophys 317(2):487-96
     |TOP1
Cell Cycle Phase Involved
RNA Levels and Processing
Regulation of
Kukuruzinska MA and Lennon K (1994) Growth-related coordinate regulation of the early N-glycosylation genes in yeast. Glycobiology 4(4):437-43
     |ALG1 |ALG2
Reviews
Herscovics A and Orlean P (1993) Glycoprotein biosynthesis in yeast. FASEB J 7(6):540-50
       |ALG1 |ALG2 |ALG3 |ALG5 |ALG6 |ALG8 |ANP1 |CWH41 |DPM1 |GDA1 |GFA1 |KRE2 |MNN1 |MNN10 |MORE
Non-Fungal Related Genes/Proteins
Zhu XY and Lehrman MA (1990) Cloning, sequence, and expression of a cDNA encoding hamster UDP-GlcNAc:dolichol phosphate N-acetylglucosamine-1-phosphate transferase. J Biol Chem 265(24):14250-5

DNA/RNA Sequence Features
Function/Process
Protein/Nucleic Acid Structure
Albright CF, et al. (1989) A 13-amino acid peptide in three yeast glycosyltransferases may be involved in dolichol recognition. Proc Natl Acad Sci U S A 86(19):7366-9
     |ALG1 |DPM1 |SEC59
Non-Fungal Related Genes/Proteins
Lehrman MA, et al. (1988) Amplification and molecular cloning of the hamster tunicamycin-sensitive N-acetylglucosamine-1-phosphate transferase gene. The hamster and yeast enzymes share a common peptide sequence. J Biol Chem 263(36):19796-803

Non-Fungal Related Genes/Proteins
Scocca JR, et al. (1988) Evidence of gene amplification in tunicamycin-resistant Chinese hamster ovary cells. Biochem Biophys Res Commun 156(3):1063-9

DNA/RNA Sequence Features
Function/Process
RNA Levels and Processing
Kukuruzinska MA and Robbins PW (1987) Protein glycosylation in yeast: transcript heterogeneity of the ALG7 gene. Proc Natl Acad Sci U S A 84(8):2145-9

Function/Process
Mutants/Phenotypes
Barnes G, et al. (1984) Asparagine-linked glycosylation in Saccharomyces cerevisiae: genetic analysis of an early step. Mol Cell Biol 4(11):2381-8

Function/Process
Regulation of
Substrates/Ligands/Cofactors
Hanson BA (1984) Role of inositol-containing sphingolipids in Saccharomyces cerevisiae during inositol starvation. J Bacteriol 159(3):837-42

Function/Process
Mutants/Phenotypes
Strains/Constructs
Rine J, et al. (1983) Targeted selection of recombinant clones through gene dosage effects. Proc Natl Acad Sci U S A 80(22):6750-4
     |HMG1 |HMG2
Other Features
Regulation of
Lehle L and Tanner W (1976) The specific site of tunicamycin inhibition in the formation of dolichol-bound N-acetylglucosamine derivatives. FEBS Lett 72(1):167-70

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.