---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

ROT2/YBR229C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrII: 679216 to 676352 CDS: 679216 - 676352 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
ROT2	YBR229C	GLS2	ORF, Verified	S000000433
Description
Glucosidase II catalytic subunit required for normal cell wall synthesis; mutations in rot2 suppress tor2 mutations, and are synthetically lethal with rot1 mutations

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By alpha-glucosidase activity Simons JF, et al. (1998) Cell wall 1,6-beta-glucan synthesis in Saccharomyces cerevisiae depends on ER glucosidases I and II, and the molecular chaperone BiP/Kar2p. EMBO J 17(2):396-405        IDA : Inferred from Direct Assay Assigned on 2006-01-19 SGD glucan 1,3-alpha-glucosidase activity GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.      IEA : Inferred from Electronic Annotation with IUBMB:3.2.1.84 Assigned on 2008-02-13 UniProtKB hydrolase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0378 Assigned on 2007-05-23 UniProtKB hydrolase activity, acting on glycosyl bonds GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0326 Assigned on 2007-05-23 UniProtKB hydrolase activity, hydrolyzing O-glycosyl compounds DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR000322 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By carbohydrate metabolic process DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR000322 Assigned on 2009-10-01 UniProtKB fungal-type cell wall biogenesis Simons JF, et al. (1998) Cell wall 1,6-beta-glucan synthesis in Saccharomyces cerevisiae depends on ER glucosidases I and II, and the molecular chaperone BiP/Kar2p. EMBO J 17(2):396-405        IMP : Inferred from Mutant Phenotype Assigned on 2002-07-08 SGD metabolic process GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0326 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By alpha-glucosidase II complex Wilkinson BM, et al. (2006) Yeast GTB1 encodes a subunit of glucosidase II required for glycoprotein processing in the endoplasmic reticulum. J Biol Chem 281(10):6325-33        IPI : Inferred from Physical Interaction with SGD:GTB1 Assigned on 2008-01-03 SGD endoplasmic reticulum Trombetta ES, et al. (1996) Endoplasmic reticulum glucosidase II is composed of a catalytic subunit, conserved from yeast to mammals, and a tightly bound noncatalytic HDEL-containing subunit. J Biol Chem 271(44):27509-16        ISS : Inferred from Sequence or structural Similarity Assigned on 2002-07-08 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0095 Assigned on 2008-02-13 UniProtKB endoplasmic reticulum lumen Wilkinson BM, et al. (2006) Yeast GTB1 encodes a subunit of glucosidase II required for glycoprotein processing in the endoplasmic reticulum. J Biol Chem 281(10):6325-33        IDA : Inferred from Direct Assay Assigned on 2006-01-19 SGD mitochondrion Sickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12          IDA : Inferred from Direct Assay Assigned on 2004-09-28 SGD Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54            IDA : Inferred from Direct Assay Assigned on 2006-12-12 SGD

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for ROT2/YBR229C for ROT2 During N-linked glycosylation of proteins, oligosaccharide chains are assembled on the carrier molecule dolichyl pyrophosphate in the following order: 2 molecules of N-acetylglucosamine (GlcNAc), 9 molecules of mannose, and 3 molecules of glucose. These 14-residue oligosaccharide cores are then transferred to asparagine residues on nascent polypeptide chains in the endoplasmic reticulum (ER). As proteins progress through the Golgi apparatus, the oligosaccharide cores are modified by trimming and extension to generate a diverse array of glycosylated proteins (reviewed in 1, 2). ROT2, also known as GLS2, encodes glucosidase II, a lumenal enzyme of the ER. After Cwh41p (glucosidase I) removes the most distal glucose from N-linked oligosaccharides (3), Rot2p trims the two remaining glucose moieties previously added by Alg8p and Alg6p. Human (OMIM) and rat glucosidase II each consist of two subunits: a catalytic alpha subunit, which is the homolog of ROT2, and a beta subunit whose putative role is to target the enzyme to the ER (3, 4). While no beta subunit has been identified in yeast, Rot2p lacks an obvious transmembrane domain or ER retention signal (3). (Note: humans have a second, unrelated glucosidase II (OMIM) involved in glycogen metabolism.) Mutants lacking Rot2p have no detectable growth defect (3) but have reduced levels of beta-1,6-glucan (5) and elevated levels of chitin (6) in the cell walls. In mutants lacking Rot2p, removal of the outermost glucose from N-linked oligosaccharides proceeds at normal rates, and one mannose moiety is removed at greatly reduced rates (7). Also drastically slowed is the degradation of misfolded glycosylated proteins (7). Last Updated: 2005-07-12

Basic References [TOP]

BASIC INFORMATION REFERENCES forROT2/YBR229C for ROT2 1) Herscovics A and Orlean P (1993) Glycoprotein biosynthesis in yeast. FASEB J 7(6):540-50        2) Burda P and Aebi M (1999) The dolichol pathway of N-linked glycosylation. Biochim Biophys Acta 1426(2):239-57      3) Trombetta ES, et al. (1996) Endoplasmic reticulum glucosidase II is composed of a catalytic subunit, conserved from yeast to mammals, and a tightly bound noncatalytic HDEL-containing subunit. J Biol Chem 271(44):27509-16        4) Pelletier MF, et al. (2000) The heterodimeric structure of glucosidase II is required for its activity, solubility, and localization in vivo. Glycobiology 10(8):815-27            5) Simons JF, et al. (1998) Cell wall 1,6-beta-glucan synthesis in Saccharomyces cerevisiae depends on ER glucosidases I and II, and the molecular chaperone BiP/Kar2p. EMBO J 17(2):396-405        6) Bickle M, et al. (1998) Cell wall integrity modulates RHO1 activity via the exchange factor ROM2. EMBO J 17(8):2235-45        7) Jakob CA, et al. (1998) Degradation of misfolded endoplasmic reticulum glycoproteins in Saccharomyces cerevisiae is determined by a specific oligosaccharide structure. J Cell Biol 142(5):1223-33

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for ROT2/YBR229C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for ROT2/YBR229C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MVLLKWL C-term EDWEVIF Length(aa) 954 MW(Da) 110,265 pI 6.11 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.107   Codon Adaptation Index 0.167   Frequency of Optimal Codons 0.485   Hydropathicity of Protein -0.336   Aromaticity Score 0.129

10 20 30 40 50 | | | | | MVLLKWLVCQLVFFTAFSHAFTDYLLKKCAQSGFCHRNRVYAENIAKSHH CYYKVDAESIAHDPLENVLHATIIKTIPRLEGDDIAVQFPFSLSFLQDHS VRFTINEKERMPTNSSGLLISSQRFNETWKYAFDKKFQEEANRTSIPQFH FLKQKQTVNSFWSKISSFLSLSNSTADTFHLRNGDVSVEIFAEPFQLKVY WQNALKLIVNEQNFLNIEHHRTKQENFAHVLPEETTFNMFKDNFLYSKHD SMPLGPESVALDFSFMGSTNVYGIPEHATSLRLMDTSGGKEPYRLFNVDV FEYNIGTSQPMYGSIPFMFSSSSTSIFWVNAADTWVDIKYDTSKNKTMTH WISENGVIDVVMSLGPDIPTIIDKFTDLTGRPFLPPISSIGYHQCRWNYN DEMDVLTVDSQMDAHMIPYDFIWLDLEYTNDKKYFTWKQHSFPNPKRLLS KLKKLGRNLVVLIDPHLKKDYEISDRVINENVAVKDHNGNDYVGHCWPGN SIWIDTISKYGQKIWKSFFERFMDLPADLTNLFIWNDMNEPSIFDGPETT APKDLIHDNYIEERSVHNIYGLSVHEATYDAIKSIYSPSDKRPFLLTRAF FAGSQRTAATWTGDNVANWDYLKISIPMVLSNNIAGMPFIGADIAGFAED PTPELIARWYQAGLWYPFFRAHAHIDTKRREPYLFNEPLKSIVRDIIQLR YFLLPTLYTMFHKSSVTGFPIMNPMFIEHPEFAELYHIDNQFYWSNSGLL VKPVTEPGQSETEMVFPPGIFYEFASLHSFINNGTDLIEKNISAPLDKIP LFIEGGHIITMKDKYRRSSMLMKNDPYVIVIAPDTEGRAVGDLYVDDGET FGYQRGEYVETQFIFENNTLKNVRSHIPENLTGIHHNTLRNTNIEKIIIA KNNLQHNITLKDSIKVKKNGEESSLPTRSSYENDNKITILNLSLDITEDW EVIF*

Protein Structures from PDB: proteins of known structure with sequence similarity to ROT2/YBR229C, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to ROT2 Homolog Source (per PDB) Protein Alignment: ROT2 vs. Homolog External Links P-Value %Identical %Similar Alignment 2qly ( Chain: A) Crystral structure of the n-terminal subunit of human maltase-glucoamylase PDB_Info PDB_Structure Homo sapiens 3.9e-57 29 27 View alignment SCOP MMDB CATH 2qmj ( Chain: A) Crystral structure of the n-terminal subunit of human maltase-glucoamylase in complex with acarbose PDB_Info PDB_Structure Homo sapiens 3.9e-57 29 27 View alignment SCOP MMDB CATH 3ctt ( Chain: A) Crystal complex of n-terminal human maltase-glucoamylase with casuarine PDB_Info PDB_Structure Homo sapiens 3.9e-57 29 27 View alignment SCOP MMDB CATH 2g3m ( Chain: C, A, B, F, E, D) Crystal structure of the sulfolobus solfataricus alpha- glucosidase mala PDB_Info PDB_Structure Sulfolobus solfataricus Chain C = 3.0e-50 29 33 View alignment SCOP MMDB CATH Chain A = 3.0e-50 29 33 View alignment Chain B = 3.0e-50 29 33 View alignment Chain F = 3.0e-50 29 33 View alignment Chain E = 3.0e-50 29 33 View alignment Chain D = 3.0e-50 29 33 View alignment 2g3n ( Chain: A, B, C, E, F, D) Crystal structure of the sulfolobus solfataricus alpha- glucosidase mala in complex with beta-octyl-glucopyranoside PDB_Info PDB_Structure Sulfolobus solfataricus Chain A = 3.0e-50 29 33 View alignment SCOP MMDB CATH Chain B = 3.0e-50 29 33 View alignment Chain C = 3.0e-50 29 33 View alignment Chain E = 3.0e-50 29 33 View alignment Chain F = 3.0e-50 29 33 View alignment Chain D = 3.0e-50 29 33 View alignment 3ffj ( Chain: A, B) The crystal structure of the glycosyl hydrolase (family 31) from ruminococcus obeum atcc 29174 PDB_Info PDB_Structure Ruminococcus obeum ATCC 29174 Chain A = 2.1e-40 27 33 View alignment SCOP MMDB CATH Chain B = 2.1e-40 27 33 View alignment 1we5 ( Chain: B, E, A, C, D, F) Crystal structure of alpha-xylosidase from escherichia coli PDB_Info PDB_Structure Escherichia coli Chain B = 8.4e-25 24 33 View alignment SCOP MMDB CATH Chain E = 8.4e-25 24 33 View alignment Chain A = 8.4e-25 24 33 View alignment Chain C = 8.4e-25 24 33 View alignment Chain D = 8.4e-25 24 33 View alignment Chain F = 8.4e-25 24 33 View alignment 2f2h ( Chain: A, F, E, C, B, D) Structure of the yici thiosugar michaelis complex PDB_Info PDB_Structure Escherichia coli Chain A = 8.4e-25 24 33 View alignment SCOP MMDB CATH Chain F = 8.4e-25 24 33 View alignment Chain E = 8.4e-25 24 33 View alignment Chain C = 8.4e-25 24 33 View alignment Chain B = 8.4e-25 24 33 View alignment Chain D = 8.4e-25 24 33 View alignment 1xsi ( Chain: D, E, B, C, F, A) Structure of a family 31 alpha glycosidase PDB_Info PDB_Structure Escherichia coli Chain D = 8.5e-25 24 33 View alignment SCOP MMDB CATH Chain E = 8.5e-25 24 33 View alignment Chain B = 8.5e-25 24 33 View alignment Chain C = 8.5e-25 24 33 View alignment Chain F = 8.5e-25 24 33 View alignment Chain A = 8.5e-25 24 33 View alignment 1xsj ( Chain: A, F, B, C, D, E) Structure of a family 31 alpha glycosidase PDB_Info PDB_Structure Escherichia coli Chain A = 8.5e-25 24 33 View alignment SCOP MMDB CATH Chain F = 8.5e-25 24 33 View alignment Chain B = 8.5e-25 24 33 View alignment Chain C = 8.5e-25 24 33 View alignment Chain D = 8.5e-25 24 33 View alignment Chain E = 8.5e-25 24 33 View alignment 1xsk ( Chain: E, C, F, D, B, A) Structure of a family 31 alpha glycosidase glycosyl-enzyme intermediate PDB_Info PDB_Structure Escherichia coli Chain E = 8.5e-25 24 33 View alignment SCOP MMDB CATH Chain C = 8.5e-25 24 33 View alignment Chain F = 8.5e-25 24 33 View alignment Chain D = 8.5e-25 24 33 View alignment Chain B = 8.5e-25 24 33 View alignment Chain A = 8.5e-25 24 33 View alignment

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
ROT2	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YBR229C	SGD Systematic Sequence
852530	NCBI: Gene ID
NP_009788.1	NCBI: RefSeq protein version ID
NP_009788.1	NCBI: RefSeq protein version ID
6319706	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
35 curated references; 0 references not yet curated
Alias Genetic Interactions Mutants/Phenotypes Strains/Constructs	Clerc S, et al. (2009) Htm1 protein generates the N-glycan signal for glycoprotein degradation in the endoplasmic reticulum. J Cell Biol 184(1):159-72	|ALG12 |ALG3 |ALG8 |ALG9 |MNL1 |MNS1 |PDI1 |PRC1 |YOS9
Mutants/Phenotypes Regulation of Strains/Constructs	Quinn RP, et al. (2009) A novel role for Gtb1p in glucose trimming of N-linked glycans. Glycobiology 19(12):1408-16	|ALG8 |CWH41 |GTB1 |MNS1
Large-scale phenotype analysis	Tan SX, et al. (2009) Cu, Zn superoxide dismutase and NADP(H) homeostasis are required for tolerance of endoplasmic reticulum stress in Saccharomyces cerevisiae. Mol Biol Cell 20(5):1493-508	|AAT2 |ADO1 |AIM26 |ALG7 |ARO2 |BCK1 |BUR2 |CCS1 |CNB1 |CNM67 |CRZ1 |CSG2 |ELP2 |ERG2 |MORE
Alias Fungal Related Genes/Proteins	Deshpande N, et al. (2008) Protein glycosylation pathways in filamentous fungi. Glycobiology 18(8):626-37	|ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG6 |ALG7 |ALG8 |ALG9 |ANP1 |CWH41 |DIE2 |MORE
Mutants/Phenotypes	Herrero AB, et al. (2008) Levels of SCS7/FA2H-Mediated Fatty Acid 2-Hydroxylation Determine the Sensitivity of Cells to Antitumor PM02734. Cancer Res 68(23):9779-87	|AIM44 |ALD6 |ALG6 |API2 |APL1 |APL5 |APM3 |ATP15 |ATP4 |ATP5 |ATP7 |BRE5 |BST1 |CAT5 |MORE
Reviews	Jigami Y (2008) Yeast glycobiology and its application. Biosci Biotechnol Biochem 72(3):637-48	|ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG5 |ALG6 |ALG7 |ALG8 |ALG9 |ANP1 |CWH41 |MORE
Mutants/Phenotypes	Loukin S, et al. (2008) A genome-wide survey suggests an osmoprotective role for vacuolar Ca2+ release in cell wall-compromised yeast. FASEB J 22(7):2405-15	|ALG5 |ALG6 |ALG8 |BST1 |CSF1 |DIE2 |GAS1 |GDA1 |GUP1 |HHY1 |HUR1 |KRE1 |KRE6 |LAS21 |MORE
Mutants/Phenotypes Non-Fungal Related Genes/Proteins	McCue PP and Phang JM (2008) Identification of Human Intracellular Targets of the Medicinal Herb St. John's Wort by Chemical-Genetic Profiling in Yeast. J Agric Food Chem 56(22):11011-11017	|ABD1 |ACS1 |ADP1 |AHC1 |APN2 |ASR1 |ATP5 |BCK2 |BFR1 |CBP6 |CHK1 |CIN8 |CRR1 |CTF19 |MORE
Fungal Related Genes/Proteins	Mora-Montes HM, et al. (2007) Endoplasmic Reticulum {alpha}-Glycosidases of Candida albicans Are Required for N Glycosylation, Cell Wall Integrity, and Normal Host-Fungus Interaction. Eukaryot Cell 6(12):2184-93	|CWH41 |MNS1
Regulatory Role Transcription	Wu D, et al. (2007) Covert genetic selections to optimize phenotypes. PLoS ONE 2(11):e1200	|BET2 |EGD2 |FUN12 |LSM3 |MLC2 |RPL5 |RPS9A |RPS9B |SFB2 |SLM1 |UTP10
Reviews	Lesage G and Bussey H (2006) Cell wall assembly in Saccharomyces cerevisiae. Microbiol Mol Biol Rev 70(2):317-43	|ANP1 |BGL2 |BIG1 |CDA1 |CDA2 |CHS1 |CHS2 |CHS3 |CHS6 |CHS7 |CNE1 |CRH1 |CRR1 |CTS1 |MORE
Cellular Location	Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54	|AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACN9 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |MORE
Protein-protein Interactions	Welsh LM, et al. (2006) Genetic and molecular interactions of the Erv41p-Erv46p complex involved in transport between the endoplasmic reticulum and Golgi complex. J Cell Sci 119(Pt 22):4730-40	|ERV41 |ERV46 |VMA21 |VMA22 |VPH2 |VPS1
Cellular Location Function/Process Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Wilkinson BM, et al. (2006) Yeast GTB1 encodes a subunit of glucosidase II required for glycoprotein processing in the endoplasmic reticulum. J Biol Chem 281(10):6325-33	|GTB1
Regulatory Role	Gardocki ME, et al. (2005) Genomic analysis of PIS1 gene expression. Eukaryot Cell 4(3):604-14	|AAD4 |ACB1 |ACE2 |ADH2 |APT1 |ATG17 |ATG19 |ATG27 |ATG29 |BAS1 |CIK1 |COQ4 |CPD1 |CPS1 |MORE
Cross-species Expression	Schirawski J, et al. (2005) Endoplasmic reticulum glucosidase II is required for pathogenicity of Ustilago maydis. Plant Cell 17(12):3532-43	|ROT1
Function/Process Genetic Interactions	Schuldiner M, et al. (2005) Exploration of the function and organization of the yeast early secretory pathway through an epistatic miniarray profile. Cell 123(3):507-19	|ALG12 |ALG3 |ALG5 |ALG6 |ALG8 |ALG9 |API2 |APL5 |APL6 |APM3 |APS3 |ARL1 |ARL3 |ARV1 |MORE
Non-Fungal Related Genes/Proteins Other Features	Tomich CH, et al. (2005) Homology modeling and molecular interaction field studies of alpha-glucosidases as a guide to structure-based design of novel proposed anti-HIV inhibitors. J Comput Aided Mol Des 19(2):83-92	|CWH41
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Hitt R and Wolf DH (2004) DER7, encoding alpha-glucosidase I is essential for degradation of malfolded glycoproteins of the endoplasmic reticulum. FEMS Yeast Res 4(8):815-20	|CWH41
Genetic Interactions Strains/Constructs	Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13	|AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Cellular Location	Sickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12	|AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |ADK2 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Avaro S, et al. (2002) Mutants defective in secretory/vacuolar pathways in the EUROFAN collection of yeast disruptants. Yeast 19(4):351-71	|ALG12 |ALG9 |APM3 |ERV29 |GAS1 |MON2 |OST2 |OST4 |RCY1 |SYS1 |TLG2 |VAC7 |VAM6 |VPS53 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	de Groot PW, et al. (2001) A genomic approach for the identification and classification of genes involved in cell wall formation and its regulation in Saccharomyces cerevisiae. Comp Funct Genomics 2(3):124-42	|AAD4 |AIM22 |ALG12 |ALK2 |ARE2 |ARG2 |ARP5 |ASI2 |ATG4 |ATG9 |AVL9 |AVT1 |AVT4 |BFA1 |MORE
Alias Function/Process	Cipollo JF and Trimble RB (2000) The accumulation of Man(6)GlcNAc(2)-PP-dolichol in the Saccharomyces cerevisiae Deltaalg9 mutant reveals a regulatory role for the Alg3p alpha1,3-Man middle-arm addition in downstream oligosaccharide-lipid and glycoprotein glycan processing. J Biol Chem 275(6):4267-77	|ALG3 |ALG6 |ALG8 |ALG9 |CWH41 |DIE2 |OCH1 |SEC18
Reviews	Herscovics A (1999) Processing glycosidases of Saccharomyces cerevisiae. Biochim Biophys Acta 1426(2):275-85	|CWH41 |MNS1
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Bickle M, et al. (1998) Cell wall integrity modulates RHO1 activity via the exchange factor ROM2. EMBO J 17(8):2235-45	|BIG1 |CWH41 |FKS1 |GAS1 |RHO1 |ROM2 |ROT1 |SAC7 |TOR2
Substrates/Ligands/Cofactors	Jakob CA, et al. (1998) Degradation of misfolded endoplasmic reticulum glycoproteins in Saccharomyces cerevisiae is determined by a specific oligosaccharide structure. J Cell Biol 142(5):1223-33	|ALG12 |ALG9 |MNS1 |PRC1
Mutants/Phenotypes Other Features Strains/Constructs	Jakob CA, et al. (1998) Genetic tailoring of N-linked oligosaccharides: the role of glucose residues in glycoprotein processing of Saccharomyces cerevisiae in vivo. Glycobiology 8(2):155-64	|ALG6 |ALG8 |DIE2 |SEC18
Alias Function/Process	Simons JF, et al. (1998) Cell wall 1,6-beta-glucan synthesis in Saccharomyces cerevisiae depends on ER glucosidases I and II, and the molecular chaperone BiP/Kar2p. EMBO J 17(2):396-405	|CWH41 |KAR2
Non-Fungal Related Genes/Proteins	Freeze HH, et al. (1997) Consequences of disrupting the gene that encodes alpha-glucosidase II in the N-linked oligosaccharide biosynthesis pathway of Dictyostelium discoideum. Dev Genet 21(3):177-86
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Schmidt A, et al. (1997) The yeast phosphatidylinositol kinase homolog TOR2 activates RHO1 and RHO2 via the exchange factor ROM2. Cell 88(4):531-42	|ACT1 |BAG7 |BEM2 |BEM3 |RHO1 |RHO2 |ROM2 |ROT1 |SAC7 |TOR2
Alias Cellular Location Function/Process Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Sequence Features Strains/Constructs	Trombetta ES, et al. (1996) Endoplasmic reticulum glucosidase II is composed of a catalytic subunit, conserved from yeast to mammals, and a tightly bound noncatalytic HDEL-containing subunit. J Biol Chem 271(44):27509-16
Function/Process Other Features Substrates/Ligands/Cofactors	Braun C, et al. (1995) Mechanism-based inhibition of yeast alpha-glucosidase and human pancreatic alpha-amylase by a new class of inhibitors. 2-Deoxy-2,2-difluoro-alpha-glycosides. J Biol Chem 270(45):26778-81
Function/Process Protein Physical Properties Substrates/Ligands/Cofactors Techniques and Reagents	Saunier B, et al. (1982) Inhibition of N-linked complex oligosaccharide formation by 1-deoxynojirimycin, an inhibitor of processing glucosidases. J Biol Chem 257(23):14155-61	|CWH41 |MNS1
Fungal Related Genes/Proteins Regulation of	Bhanot P and Brown RG (1980) Effect of 3-O-methyl-D-glucose on the production of glycosidases by Cryptococcus laurentii and Saccharomyces cerevisiae. Can J Microbiol 26(11):1289-95	|FSP2 |GTB1 |MAL12 |MAL22 |MAL32 |MAL42 |MAL62 |SUC1 |SUC2 |SUC3 |SUC4 |SUC5 |SUC7 |YIL172C |MORE

Return to SGD

Send a Message to the SGD Curators