---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

ERV15/YBR210W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrII: 645545 to 645973 CDS: 645545 - 645973 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
ERV15	YBR210W		ORF, Verified	S000000414
Description
Protein involved in export of proteins from the endoplasmic reticulum, has similarity to Erv14p

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By molecular_function unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD    ND : No Biological Data Available Assigned on 2003-04-09 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By ER to Golgi vesicle-mediated transport Nakanishi H, et al. (2007) Erv14 family cargo receptors are necessary for ER exit during sporulation in Saccharomyces cerevisiae. J Cell Sci 120(Pt 5):908-16      IGI : Inferred from Genetic Interaction with SGD:ERV14 Assigned on 2007-02-22 SGD axial cellular bud site selection Powers J and Barlowe C (1998) Transport of axl2p depends on erv14p, an ER-vesicle protein related to the Drosophila cornichon gene product. J Cell Biol 142(5):1209-22        ISS : Inferred from Sequence or structural Similarity Assigned on 2003-04-09 SGD intracellular signaling cascade DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR003377 Assigned on 2007-05-23 UniProtKB translational elongation Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component Annotation(s) Reference(s) Evidence Assigned By ER to Golgi transport vesicle Nakanishi H, et al. (2007) Erv14 family cargo receptors are necessary for ER exit during sporulation in Saccharomyces cerevisiae. J Cell Sci 120(Pt 5):908-16      IGI : Inferred from Genetic Interaction with SGD:ERV14 Assigned on 2007-02-22 SGD integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR003377 Assigned on 2009-06-17 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forERV15/YBR210W for ERV15 1) Powers J and Barlowe C (1998) Transport of axl2p depends on erv14p, an ER-vesicle protein related to the Drosophila cornichon gene product. J Cell Biol 142(5):1209-22        2) Nakanishi H, et al. (2007) Erv14 family cargo receptors are necessary for ER exit during sporulation in Saccharomyces cerevisiae. J Cell Sci 120(Pt 5):908-16

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for ERV15/YBR210W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for ERV15/YBR210W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MSGTGLS C-term NDANLIS Length(aa) 142 MW(Da) 16,347 pI 8.04 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.016   Codon Adaptation Index 0.105   Frequency of Optimal Codons 0.410   Hydropathicity of Protein 0.694   Aromaticity Score 0.169	10 20 30 40 50 | | | | | MSGTGLSLFVTGLILNCLNSICQIYFTILYGDLEADYINSIELCKRVNRL SVPEAILQAFISALFLFNGYWFVFLLNVPVLAYNASKVYKKTHLLDATDI FRKLGRCKIECFLKLGFYLLIFFFYFYRMVTALLENDANLIS*

Protein Structures from PDB: proteins of known structure with sequence similarity to ERV15/YBR210W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
ERV15	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YBR210W	SGD Systematic Sequence
852511	NCBI: Gene ID
NP_009769.1	NCBI: RefSeq protein version ID
NP_009769.1	NCBI: RefSeq protein version ID
6319687	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
5 curated references; 0 references not yet curated
Evolution Fungal Related Genes/Proteins Protein Sequence Features	Turunen O, et al. (2009) In silico evidence for functional specialization after genome duplication in yeast. FEMS Yeast Res 9(1):16-31	|ACC1 |ADH1 |ADH5 |CDC19 |CET1 |CTL1 |ELO1 |ERV14 |FEN1 |GCS1 |GRS1 |GRS2 |HFA1 |MCK1 |MORE
Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Strains/Constructs	Nakanishi H, et al. (2007) Erv14 family cargo receptors are necessary for ER exit during sporulation in Saccharomyces cerevisiae. J Cell Sci 120(Pt 5):908-16	|DTR1 |ERV14 |GCS1 |MSO1 |PMA1 |RCY1 |SEC22 |SMA1 |SMA2 |SSO1 |VPS13
Cellular Location Protein Physical Properties	Kim H, et al. (2003) Topology models for 37 Saccharomyces cerevisiae membrane proteins based on C-terminal reporter fusions and predictions. J Biol Chem 278(12):10208-13	|AQY1 |ASG7 |ATO2 |AVT6 |CDC1 |ECM7 |ERP2 |FCY2 |FLD1 |HHY1 |IZH4 |MEP1 |MUP1 |OSW5 |MORE
Mutants/Phenotypes Strains/Constructs	Rodriguez-Navarro S, et al. (1999) Functional analysis of 12 ORFs from Saccharomyces cerevisiae chromosome II. Yeast 15(10B):913-9	|AIM4 |AME1 |ATG12 |COS111 |DER1 |FTH1 |MED8 |SLX1 |TAF5 |YBR197C |YBR209W
Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Powers J and Barlowe C (1998) Transport of axl2p depends on erv14p, an ER-vesicle protein related to the Drosophila cornichon gene product. J Cell Biol 142(5):1209-22	|AXL2 |ERV14

Return to SGD

Send a Message to the SGD Curators