---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

ALG1/YBR110W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrII: 458866 to 460215 CDS: 458866 - 460215 Genetic position: 54 cM Genetic Map Data Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
ALG1	YBR110W		ORF, Verified	S000000314
Description
Mannosyltransferase, involved in asparagine-linked glycosylation in the endoplasmic reticulum (ER); essential for viability, mutation is functionally complemented by human ortholog

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By beta-1,4-mannosyltransferase activity Couto JR, et al. (1984) Cloning and expression in Escherichia coli of a yeast mannosyltransferase from the asparagine-linked glycosylation pathway. J Biol Chem 259(1):378-82      IDA : Inferred from Direct Assay Assigned on 2002-09-02 SGD chitobiosyldiphosphodolichol beta-mannosyltransferase activity GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.      IEA : Inferred from Electronic Annotation with IUBMB:2.4.1.142 Assigned on 2007-05-23 UniProtKB transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0808 Assigned on 2007-05-23 UniProtKB transferase activity, transferring glycosyl groups GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0328 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By biosynthetic process DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001296 Assigned on 2007-05-23 UniProtKB oligosaccharide-lipid intermediate assembly Huffaker TC and Robbins PW (1982) Temperature-sensitive yeast mutants deficient in asparagine-linked glycosylation. J Biol Chem 257(6):3203-10      IMP : Inferred from Mutant Phenotype Assigned on 2005-03-01 SGD protein amino acid N-linked glycosylation Huffaker TC and Robbins PW (1983) Yeast mutants deficient in protein glycosylation. Proc Natl Acad Sci U S A 80(24):7466-70      IMP : Inferred from Mutant Phenotype Assigned on 2002-09-02 SGD
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum Gao XD, et al. (2004) Physical interactions between the Alg1, Alg2, and Alg11 mannosyltransferases of the endoplasmic reticulum. Glycobiology 14(6):559-70              IPI : Inferred from Physical Interaction with SGD:ALG11 Assigned on 2005-03-01 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB integral to membrane Albright CF and Robbins RW (1990) The sequence and transcript heterogeneity of the yeast gene ALG1, an essential mannosyltransferase involved in N-glycosylation. J Biol Chem 265(12):7042-9      ISS : Inferred from Sequence or structural Similarity Assigned on 2003-02-04 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9906 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
lipid-linked oligosaccharide biosynthesis

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for ALG1/YBR110W for ALG1 During N-linked glycosylation of proteins, oligosaccharide chains are assembled on the carrier molecule dolichyl pyrophosphate in the following order: 2 molecules of N-acetylglucosamine (GlcNAc), 9 molecules of mannose, and 3 molecules of glucose. These 14-residue oligosaccharide cores are then transferred to asparagine residues on nascent polypeptide chains in the endoplasmic reticulum (ER). As proteins progress through the Golgi apparatus, the oligosaccharide cores are modified by trimming and extension to generate a diverse array of glycosylated proteins (reviewed in 1, 2). Alg1p, which is a beta 1,4 mannosyltransferase, catalyzes the addition of the first mannose moiety to the growing lipid-linked oligosaccharide (LLO) (3, 4) on the cytosolic side of the endoplasmic reticulum. Mutants cannot add mannose to Dol-PP-GlcNAc2, but are able to convert Man1-Dol-PP-GlcNAc2 to Man5-Dol-PP-GlcNAc2 (3). Alg1p forms two different multimeric complexes, one with Alg2p and the other with Alg11p (5). Alg1p is homologous to Dictyostelium discoideum MntAp (6). Human ALG1 (OMIM), also known as mannosyltransferase I, complements the yeast alg1-1 mutation (7, 8) and has been found to be mutated in the congenital disorder of glycosylation CDG-1k (OMIM) (7, 8). Last Updated: 2005-07-12

Basic References [TOP]

BASIC INFORMATION REFERENCES forALG1/YBR110W for ALG1 1) Herscovics A and Orlean P (1993) Glycoprotein biosynthesis in yeast. FASEB J 7(6):540-50        2) Burda P and Aebi M (1999) The dolichol pathway of N-linked glycosylation. Biochim Biophys Acta 1426(2):239-57      3) Huffaker TC and Robbins PW (1982) Temperature-sensitive yeast mutants deficient in asparagine-linked glycosylation. J Biol Chem 257(6):3203-10      4) Couto JR, et al. (1984) Cloning and expression in Escherichia coli of a yeast mannosyltransferase from the asparagine-linked glycosylation pathway. J Biol Chem 259(1):378-82      5) Gao XD, et al. (2004) Physical interactions between the Alg1, Alg2, and Alg11 mannosyltransferases of the endoplasmic reticulum. Glycobiology 14(6):559-70              6) Lee SK, et al. (1997) The Dictyostelium discoideum beta-1,4-mannosyltransferase gene, mntA, has two periods of developmental expression. Gene 204(1-2):251-8          7) Grubenmann CE, et al. (2004) Deficiency of the first mannosylation step in the N-glycosylation pathway causes congenital disorder of glycosylation type Ik. Hum Mol Genet 13(5):535-42        8) Schwarz M, et al. (2004) Deficiency of GDP-Man:GlcNAc2-PP-dolichol mannosyltransferase causes congenital disorder of glycosylation type Ik. Am J Hum Genet 74(3):472-81        9) Albright CF and Robbins RW (1990) The sequence and transcript heterogeneity of the yeast gene ALG1, an essential mannosyltransferase involved in N-glycosylation. J Biol Chem 265(12):7042-9      10) Takahashi T, et al. (2000) Cloning of the human cDNA which can complement the defect of the yeast mannosyltransferase I-deficient mutant alg 1. Glycobiology 10(3):321-7

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for ALG1/YBR110W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for ALG1/YBR110W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MFLEIPR C-term RDLKLIH Length(aa) 449 MW(Da) 51,929 pI 9.31 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.034   Codon Adaptation Index 0.141   Frequency of Optimal Codons 0.431   Hydropathicity of Protein 0.035   Aromaticity Score 0.120

10 20 30 40 50 | | | | | MFLEIPRWLLALIILYLSIPLVVYYVIPYLFYGNKSTKKRIIIFVLGDVG HSPRICYHAISFSKLGWQVELCGYVEDTLPKIISSDPNITVHHMSNLKRK GGGTSVIFMVKKVLFQVLSIFKLLWELRGSDYILVQNPPSIPILPIAVLY KLTGCKLIIDWHNLAYSILQLKFKGNFYHPLVLISYMVEMIFSKFADYNL TVTEAMRKYLIQSFHLNPKRCAVLYDRPASQFQPLAGDISRQKALTTKAF IKNYIRDDFDTEKGDKIIVTSTSFTPDEDIGILLGALKIYENSYVKFDSS LPKILCFITGKGPLKEKYMKQVEEYDWKRCQIEFVWLSAEDYPKLLQLCD YGVSLHTSSSGLDLPMKILDMFGSGLPVIAMNYPVLDELVQHNVNGLKFV DRRELHESLIFAMKDADLYQKLKKNVTQEAENRWQSNWERTMRDLKLIH*

Protein Structures from PDB: proteins of known structure with sequence similarity to ALG1/YBR110W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
ALG1	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YBR110W	SGD Systematic Sequence
852407	NCBI: Gene ID
NP_009668.1	NCBI: RefSeq protein version ID
NP_009668.1	NCBI: RefSeq protein version ID
6319586	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
39 curated references; 0 references not yet curated
Mutants/Phenotypes Strains/Constructs	Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8	|AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |AOS1 |MORE
Fungal Related Genes/Proteins	Deshpande N, et al. (2008) Protein glycosylation pathways in filamentous fungi. Glycobiology 18(8):626-37	|ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG6 |ALG7 |ALG8 |ALG9 |ANP1 |CWH41 |DIE2 |DPM1 |MORE
Reviews	Jigami Y (2008) Yeast glycobiology and its application. Biosci Biotechnol Biochem 72(3):637-48	|ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG5 |ALG6 |ALG7 |ALG8 |ALG9 |ANP1 |CWH41 |DIE2 |MORE
Protein Physical Properties	White MA, et al. (2007) Characteristics affecting expression and solubilization of yeast membrane proteins. J Mol Biol 365(3):621-36	|ALG7 |APQ12 |AQY1 |ARE2 |ATG9 |ATP4 |BET1 |BIG1 |BOS1 |BRR6 |CAX4 |CHO1 |COS7 |COS8 |MORE
Reviews	Lehle L, et al. (2006) Protein glycosylation, conserved from yeast to man: a model organism helps elucidate congenital human diseases. Angew Chem Int Ed Engl 45(41):6802-18	|ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG5 |ALG6 |ALG7 |ALG8 |ALG9 |DIE2 |DPM1 |OST1 |MORE
Function/Process Strains/Constructs Substrates/Ligands/Cofactors	O'Reilly MK, et al. (2006) In vitro evidence for the dual function of Alg2 and Alg11: essential mannosyltransferases in N-linked glycoprotein biosynthesis. Biochemistry 45(31):9593-603	|ALG11 |ALG2
Reviews	Weerapana E and Imperiali B (2006) Asparagine-linked protein glycosylation: from eukaryotic to prokaryotic systems. Glycobiology 16(6):91R-101R	|ALG11 |ALG13 |ALG14 |ALG2 |ALG7 |ALG9 |OST1 |OST2 |OST3 |OST4 |OST5 |OST6 |RFT1 |SEC11 |MORE
Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins	Samuelson J, et al. (2005) The diversity of dolichol-linked precursors to Asn-linked glycans likely results from secondary loss of sets of glycosyltransferases. Proc Natl Acad Sci U S A 102(5):1548-53	|ALG11 |ALG2 |ALG5 |ALG7 |DPM1 |STT3
Protein-protein Interactions Strains/Constructs	Yan A and Lennarz WJ (2005) Two oligosaccharyl transferase complexes exist in yeast and associate with two different translocons. Glycobiology 15(12):1407-15	|OST1 |OST2 |OST3 |OST4 |OST5 |OST6 |SBH1 |SBH2 |SWP1 |WBP1
Cellular Location Genetic Interactions Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs	Gao XD, et al. (2004) Physical interactions between the Alg1, Alg2, and Alg11 mannosyltransferases of the endoplasmic reticulum. Glycobiology 14(6):559-70	|ALG11 |ALG2
Cross-species Expression Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Grubenmann CE, et al. (2004) Deficiency of the first mannosylation step in the N-glycosylation pathway causes congenital disorder of glycosylation type Ik. Hum Mol Genet 13(5):535-42
Cross-species Expression Disease Gene Related Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Schwarz M, et al. (2004) Deficiency of GDP-Man:GlcNAc2-PP-dolichol mannosyltransferase causes congenital disorder of glycosylation type Ik. Am J Hum Genet 74(3):472-81
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Janik A, et al. (2003) Overexpression of GDP-mannose pyrophosphorylase in Saccharomyces cerevisiae corrects defects in dolichol-linked saccharide formation and protein glycosylation. Biochim Biophys Acta 1621(1):22-30	|ALG2 |DPM1 |PSA1
Function/Process Mutants/Phenotypes Strains/Constructs	Cullen PJ, et al. (2000) Defects in protein glycosylation cause SHO1-dependent activation of a STE12 signaling pathway in yeast. Genetics 155(3):1005-18	|DPM1 |FUS1 |HOG1 |KSS1 |MNN10 |OCH1 |PGI1 |PMI40 |PSA1 |RER2 |SHO1 |SPT14 |STE11 |STE12 |MORE
Fungal Related Genes/Proteins	Takahashi T, et al. (2000) Cloning of the human cDNA which can complement the defect of the yeast mannosyltransferase I-deficient mutant alg 1. Glycobiology 10(3):321-7
Function/Process Mutants/Phenotypes Strains/Constructs	Mazhari-Tabrizi R, et al. (1999) Chromosomal promoter replacement in Saccharomyces cerevisiae: construction of conditional lethal strains for the cloning of glycosyltransferases from various organisms. Glycoconj J 16(11):673-9	|ALG7 |DPM1 |GAA1 |GPI2 |PIS1 |SEC59 |SPT14 |WBP1
Mutants/Phenotypes	Cueva R, et al. (1998) N-glycosylation by transfer of GlcNAc2 from dolichol-PP-GlcNAc2 to the protein moiety of the major yeast exoglucanase. Yeast 14(8):773-81
Mutants/Phenotypes Strains/Constructs	Roy SK, et al. (1998) Functional evidence for UDP-galactose transporter in Saccharomyces cerevisiae through the in vivo galactosylation and in vitro transport assay. J Biol Chem 273(5):2583-90	|MNN1
Non-Fungal Related Genes/Proteins Protein Sequence Features	Lee SK, et al. (1997) The Dictyostelium discoideum beta-1,4-mannosyltransferase gene, mntA, has two periods of developmental expression. Gene 204(1-2):251-8
Function/Process Mutants/Phenotypes Strains/Constructs	Shimma Y, et al. (1997) A defect in GTP synthesis affects mannose outer chain elongation in Saccharomyces cerevisiae. Mol Gen Genet 256(5):469-80	|GUK1 |PSA1 |SEC20
Cell Cycle Phase Involved Function/Process Genetic Interactions Mutants/Phenotypes	Benton BK, et al. (1996) Over-expression of S. cerevisiae G1 cyclins restores the viability of alg1 N-glycosylation mutants. Curr Genet 29(2):106-13	|CLN1 |CLN2 |CLN3 |PSA1
Other Features	Papatsenko DA, et al. (1996) Mapping of DNA-binding proteins along the yeast genome by UV-induced DNA-protein crosslinking. FEBS Lett 381(1-2):103-5	|TKL2
Mutants/Phenotypes Techniques and Reagents	Schwientek T, et al. (1996) Golgi localization and in vivo activity of a mammalian glycosyltransferase (human beta1,4-galactosyltransferase) in yeast. J Biol Chem 271(7):3398-405	|KRE2
Function/Process Protein Sequence Features	Shpakov AO and Derkach KV (1996) [Yeast dolichol-conjugated mannosyltransferases. A theoretical analysis of the primary structure and identification of the sites homologous to other enzymes of the dolichol cycle] Zh Evol Biokhim Fiziol 32(1):3-18	|ALG2
Mutants/Phenotypes Other Features Techniques and Reagents	Dean N (1995) Yeast glycosylation mutants are sensitive to aminoglycosides. Proc Natl Acad Sci U S A 92(5):1287-91	|ALG2 |ALG3 |ALG5 |ANP1 |CWH41 |MNN1 |MNN10 |MNN2 |MNN9 |SEC53 |VRG4 |WBP1
Cell Cycle Phase Involved Function/Process RNA Levels and Processing Regulation of Transcription	Lennon K, et al. (1995) Proliferation-dependent differential regulation of the dolichol pathway genes in Saccharomyces cerevisiae. Glycobiology 5(6):633-42	|ALG2 |ALG7
Cellular Location Function/Process Other Features Protein Sequence Features Protein/Nucleic Acid Structure Techniques and Reagents	Shpakov AO and Shpakova EA (1995) [Identification of repetitive sequences and internal symmetry in primary structure of yeast GDP-Man:Dol-PP-GlcNAc2 mannosyltransferase] Ukr Biokhim Zh 67(4):33-40
Cell Cycle Phase Involved Function/Process Mutants/Phenotypes Other Features RNA Levels and Processing Regulation of Transcription	Kukuruzinska MA and Lennon K (1994) Growth-related coordinate regulation of the early N-glycosylation genes in yeast. Glycobiology 4(4):437-43	|ALG2 |ALG7
Function/Process Mutants/Phenotypes Protein Physical Properties Protein Sequence Features Strains/Constructs Techniques and Reagents	Revers L, et al. (1994) The potential dolichol recognition sequence of beta-1,4-mannosyltransferase is not required for enzymic activity using phytanyl-pyrophosphoryl-alpha-N,N'- diacetylchitobioside as acceptor. Biochem J 299 ( Pt 1)():23-7
Function/Process Genetic Interactions Techniques and Reagents	Roos J, et al. (1994) A screen for yeast mutants with defects in the dolichol-mediated pathway for N-glycosylation. Proc Natl Acad Sci U S A 91(4):1485-9	|ENP1 |SEC59
Reviews	Herscovics A and Orlean P (1993) Glycoprotein biosynthesis in yeast. FASEB J 7(6):540-50	|ALG2 |ALG3 |ALG5 |ALG6 |ALG7 |ALG8 |ANP1 |CWH41 |DPM1 |GDA1 |GFA1 |KRE2 |MNN1 |MNN10 |MORE
DNA/RNA Sequence Features Mapping Transcription	Mannhaupt G, et al. (1992) Molecular analysis of yeast chromosome II between CMD1 and LYS2: the excision repair gene RAD16 located in this region belongs to a novel group of double-finger proteins. Yeast 8(5):397-408	|CMD1 |CYC8 |LYS2 |PHO5 |RAD16 |RAD54 |SNF2
Cellular Location DNA/RNA Sequence Features Function/Process Mutants/Phenotypes Protein Processing/Modification/Regulation Protein Sequence Features RNA Levels and Processing Techniques and Reagents Transcription	Albright CF and Robbins RW (1990) The sequence and transcript heterogeneity of the yeast gene ALG1, an essential mannosyltransferase involved in N-glycosylation. J Biol Chem 265(12):7042-9
Cellular Location Function/Process Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins Protein Sequence Features Protein/Nucleic Acid Structure	Albright CF, et al. (1989) A 13-amino acid peptide in three yeast glycosyltransferases may be involved in dolichol recognition. Proc Natl Acad Sci U S A 86(19):7366-9	|ALG7 |DPM1 |SEC59
Function/Process Mutants/Phenotypes Other Features Techniques and Reagents	Appukuttan PS and Wu HC (1989) Fatty acylation of yeast glycoproteins proceeds independently of N-linked glycosylation. FEBS Lett 255(1):139-42	|ALG2
Function/Process Mapping Mutants/Phenotypes Strains/Constructs Techniques and Reagents	Couto JR, et al. (1984) Cloning and expression in Escherichia coli of a yeast mannosyltransferase from the asparagine-linked glycosylation pathway. J Biol Chem 259(1):378-82	|LYS2
Cell Cycle Phase Involved Mutants/Phenotypes	Klebl F, et al. (1984) A temperature-sensitive N-glycosylation mutant of S. cerevisiae that behaves like a cell-cycle mutant. Exp Cell Res 150(2):309-13
Mutants/Phenotypes Techniques and Reagents	Huffaker TC and Robbins PW (1983) Yeast mutants deficient in protein glycosylation. Proc Natl Acad Sci U S A 80(24):7466-70	|ALG2 |ALG3 |ALG5 |ALG6 |SEC53
Function/Process Mutants/Phenotypes Techniques and Reagents	Huffaker TC and Robbins PW (1982) Temperature-sensitive yeast mutants deficient in asparagine-linked glycosylation. J Biol Chem 257(6):3203-10

Return to SGD

Send a Message to the SGD Curators