---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

AAC3/YBR085W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrII: 415977 to 416900 CDS: 415977 - 416900 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
AAC3	YBR085W	ANC3	ORF, Verified	S000000289
Description
Mitochondrial inner membrane ADP/ATP translocator, exchanges cytosolic ADP for mitochondrially synthesized ATP; expressed under anaerobic conditions; similar to Pet9p and Aac1p; has roles in maintenance of viability and in respiration

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By ATP:ADP antiporter activity Kolarov J, et al. (1990) A third ADP/ATP translocator gene in yeast. J Biol Chem 265(21):12711-6      ISA : Inferred from Sequence Alignment with SGD:AAC1, SGD:PET9 Assigned on 2008-04-16 SGD binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001993 , EBI:IPR002067 Assigned on 2007-05-23 UniProtKB transporter activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR002113 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By anaerobic respiration Kolarov J, et al. (1990) A third ADP/ATP translocator gene in yeast. J Biol Chem 265(21):12711-6      IEP : Inferred from Expression Pattern IGI : Inferred from Genetic Interaction with SGD:PET9 Assigned on 2004-02-26 SGD Drgon T, et al. (1991) ADP/ATP translocator is essential only for anaerobic growth of yeast Saccharomyces cerevisiae. FEBS Lett 289(2):159-62      IGI : Inferred from Genetic Interaction with SGD:PET9, SGD:AAC1 Assigned on 2004-02-26 SGD heme biosynthetic process Azuma M, et al. (2008) Adenine nucleotide translocator transports haem precursors into mitochondria. PLoS ONE 3(8):e3070          IGI : Inferred from Genetic Interaction with SGD:AAC1, SGD:PET9 Assigned on 2008-09-09 SGD heterocycle metabolic process Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT translational elongation Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT transmembrane transport Kolarov J, et al. (1990) A third ADP/ATP translocator gene in yeast. J Biol Chem 265(21):12711-6      ISA : Inferred from Sequence Alignment with SGD:AAC1, SGD:PET9 Assigned on 2008-12-10 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR002067 , EBI:IPR002113 , EBI:IPR001993 Assigned on 2009-10-01 UniProtKB transport DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001993 , EBI:IPR002067 , EBI:IPR002113 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001993 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB mitochondrial inner membrane Kolarov J, et al. (1990) A third ADP/ATP translocator gene in yeast. J Biol Chem 265(21):12711-6      ISA : Inferred from Sequence Alignment with SGD:AAC1, SGD:PET9 Assigned on 2008-04-16 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR002067 , EBI:IPR002113 Assigned on 2009-06-17 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0999 Assigned on 2009-06-29 UniProtKB mitochondrion Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54            IDA : Inferred from Direct Assay Assigned on 2006-12-12 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0496 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forAAC3/YBR085W for AAC3 1) Kolarov J, et al. (1990) A third ADP/ATP translocator gene in yeast. J Biol Chem 265(21):12711-6      2) Chen XJ (2004) Sal1p, a calcium-dependent carrier protein that suppresses an essential cellular function associated With the Aac2 isoform of ADP/ATP translocase in Saccharomyces cerevisiae. Genetics 167(2):607-17

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for AAC3/YBR085W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for AAC3/YBR085W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations from Predicted Full length Translation N-term MSSDAKQ C-term LFGKKFK Length(aa) 307 MW(Da) 33,313 pI 10.62 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.219   Codon Adaptation Index 0.198   Frequency of Optimal Codons 0.522   Hydropathicity of Protein 0.087   Aromaticity Score 0.114	10 20 30 40 50 | | | | | MSSDAKQQETNFAINFLMGGVSAAIAKTAASPIERVKILIQNQDEMIKQG TLDKKYSGIVDCFKRTAKQEGLISFWRGNTANVIRYFPTQALNFAFKDKI KLMFGFKKEEGYGKWFAGNLASGGAAGALSLLFVYSLDFARTRLAADAKS SKKGGARQFNGLTDVYKKTLKSDGIAGLYRGFMPSVVGIVVYRGLYFGMF DSLKPLVLTGSLDGSFLASFLLGWVVTTGASTCSYPLDTVRRRMMMTSGQ AVKYNGAIDCLKKIVASEGVGSLFKGCGANILRSVAGAGVISMYDQLQMI LFGKKFK*

Protein Structures from PDB: proteins of known structure with sequence similarity to AAC3/YBR085W, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to AAC3 Homolog Source (per PDB) Protein Alignment: AAC3 vs. Homolog External Links P-Value %Identical %Similar Alignment 1okc ( Chain: A) Structure of mitochondrial adp/atp carrier in complex with carboxyatractyloside PDB_Info PDB_Structure Bos taurus 4.1e-66 53 24 View alignment SCOP MMDB CATH 2c3e ( Chain: A) The bovine mitochondrial adp-atp carrier PDB_Info PDB_Structure Bos taurus 4.1e-66 53 24 View alignment SCOP MMDB CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
AAC3	SGD (2007) Information without a citation in SGD

Mapping Notes

Date	Note
1997-10-20	Edition 14: The name ANC3, an alias for AAC3, has also been used to describe an 'actin-noncomplementing' mutant: Vinh et al., Genetics 135:275 Cherry JM, et al. (1997) Genetic and physical maps of Saccharomyces cerevisiae. Nature 387(6632 Suppl):67-73

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YBR085W	SGD Systematic Sequence
852380	NCBI: Gene ID
NP_009642.1	NCBI: RefSeq protein version ID
NP_009642.1	NCBI: RefSeq protein version ID
6319560	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) Organelle DB (UMich) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
42 curated references; 0 references not yet curated
Strains/Constructs Techniques and Reagents	Clark KM, et al. (2009) Purification of Transmembrane Proteins from Saccharomyces cerevisiae for X-ray Crystallography. Protein Expr Purif	|AAC1 |ADP1 |ALG3 |ALG7 |BOR1 |CHO1 |DGA1 |DPP1 |ENA5 |EPT1 |GPT2 |LPP1 |NFT1 |PDR10 |MORE
Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Feng J, et al. (2009) Tyrosine phosphorylation by Src within the cavity of the adenine nucleotide translocase 1 regulates ADP/ATP exchange in mitochondria. Am J Physiol Cell Physiol	|AAC1 |PET9
Evolution Non-Fungal Related Genes/Proteins	Szklarczyk R and Huynen MA (2009) Expansion of the human mitochondrial proteome by intra- and inter-compartmental protein duplication. Genome Biol 10(11):R135	|AAC1 |AAT2 |ABC1 |ACN9 |ACO1 |ACP1 |ADK1 |ADK2 |AGC1 |AHP1 |ALD4 |ALD5 |ALD6 |APN2 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Azuma M, et al. (2008) Adenine nucleotide translocator transports haem precursors into mitochondria. PLoS ONE 3(8):e3070	|AAC1 |ATP3 |CTA1 |PET9
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Mroczek S and Kufel J (2008) Apoptotic signals induce specific degradation of ribosomal RNA in yeast. Nucleic Acids Res 36(9):2874-88	|AAC1 |AHP1 |AIF1 |DOT5 |GPX1 |GPX2 |GRX1 |GRX2 |GSH1 |HTB1 |HTB2 |HYR1 |MCA1 |PET9 |MORE
Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Smith CP and Thorsness PE (2008) The Molecular Basis for Relative Physiological Functionality of the ADP/ATP Carrier Isoforms in Saccharomyces cerevisiae. Genetics 179(3):1285-99	|AAC1 |PET9 |SAL1
Genetic Interactions Strains/Constructs	Buttner S, et al. (2007) Endonuclease g regulates budding yeast life and death. Mol Cell 25(2):233-46	|AAC1 |AIF1 |HHF1 |HHF2 |HTB1 |HTB2 |KAP123 |MCA1 |NUC1 |PET9 |POR1
Function/Process Mutants/Phenotypes Strains/Constructs	Pereira C, et al. (2007) ADP/ATP carrier is required for mitochondrial outer membrane permeabilization and cytochrome c release in yeast apoptosis. Mol Microbiol 66(3):571-82	|AAC1 |ATP2 |CPR3 |MCA1 |PET9 |POR1
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC1 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |AQY1 |MORE
Cross-species Expression Fungal Related Genes/Proteins	Fontanesi F, et al. (2006) Heterologous complementation of the Klaac null mutation of Kluyveromyces lactis by the Saccharomyces cerevisiae AAC3 gene encoding the ADP/ATP carrier. FEMS Yeast Res 6(3):414-20	|AAC1 |PET9
Reviews	Palmieri F, et al. (2006) Identification of mitochondrial carriers in Saccharomyces cerevisiae by transport assay of reconstituted recombinant proteins. Biochim Biophys Acta 1757(9-10):1249-62	|AAC1 |AGC1 |ANT1 |CAT2 |CRC1 |CTP1 |DIC1 |FLX1 |GGC1 |LEU5 |MIR1 |MRS3 |MRS4 |MTM1 |MORE
Cellular Location	Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54	|AAC1 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACN9 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |ADK1 |MORE
Protein-protein Interactions Techniques and Reagents	Tagwerker C, et al. (2006) A tandem affinity tag for two-step purification under fully denaturing conditions: application in ubiquitin profiling and protein complex identification combined with in vivocross-linking. Mol Cell Proteomics 5(4):737-48	|AAC1 |ACB1 |ACC1 |ACS2 |ADE3 |ADE5,7 |ADE6 |ADH4 |ADO1 |AGP1 |AHA1 |AHP1 |ALA1 |ALD5 |MORE
Transcription	Bourges I, et al. (2005) Effect of inhibition of the bc1 complex on gene expression profile in yeast. J Biol Chem 280(33):29743-9	|COB |COX5B |CPR6 |CTA1 |CTT1 |CYB2 |CYC7 |GPX1 |HMX1 |HSP104 |HSP26 |HSP30 |HSP42 |HSP78 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Cavero S, et al. (2005) The calcium-dependent ATP-Mg/Pi mitochondrial carrier is a target of glucose-induced calcium signalling in Saccharomyces cerevisiae. Biochem J 392(Pt 3):537-44	|AAC1 |PET9 |SAL1
Cross-species Expression	Monne M, et al. (2005) Functional expression of eukaryotic membrane proteins in Lactococcus lactis. Protein Sci 14(12):3048-56	|AAC1 |DIC1 |GGC1 |MIR1 |OAC1 |ODC1 |ODC2 |PET8 |PET9
Function/Process Fungal Related Genes/Proteins Genetic Interactions Strains/Constructs	Chen XJ (2004) Sal1p, a calcium-dependent carrier protein that suppresses an essential cellular function associated With the Aac2 isoform of ADP/ATP translocase in Saccharomyces cerevisiae. Genetics 167(2):607-17	|AAC1 |PET9 |SAL1
Non-Fungal Related Genes/Proteins	Hayano T, et al. (2003) Proteomic analysis of human Nop56p-associated pre-ribosomal ribonucleoprotein complexes. Possible link between Nop56p and the nucleolar protein treacle responsible for Treacher Collins syndrome. J Biol Chem 278(36):34309-19	|ACT1 |BRX1 |CIC1 |DBP3 |EBP2 |EFT2 |GBP2 |HHO1 |HPR1 |HTB1 |LUC7 |NAP1 |NOP1 |NOP4 |MORE
Protein/Nucleic Acid Structure	Kunji ER and Harding M (2003) Projection structure of the atractyloside-inhibited mitochondrial ADP/ATP carrier of Saccharomyces cerevisiae. J Biol Chem 278(39):36985-8
Cellular Location	Sickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12	|AAC1 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |ADK2 |ADY2 |MORE
RNA Levels and Processing Regulation of	Palkova Z, et al. (2002) Ammonia pulses and metabolic oscillations guide yeast colony development. Mol Biol Cell 13(11):3901-14	|AAT1 |ACO1 |ACS1 |ADY2 |ALD4 |ALD5 |ATO2 |ATO3 |ATP15 |ATP2 |CAT2 |CHA1 |CIT3 |COX13 |MORE
Fungal Related Genes/Proteins	Wiedemann N, et al. (2001) The three modules of ADP/ATP carrier cooperate in receptor recruitment and translocation into mitochondria. EMBO J 20(5):951-60	|AAC1 |PET9 |TOM70
Function/Process Protein-Nucleic Acid Interactions	Belenkiy R, et al. (2000) The yeast mitochondrial transport proteins: new sequences and consensus residues, lack of direct relation between consensus residues and transmembrane helices, expression patterns of the transport protein genes, and protein-protein interactions with other proteins. Biochim Biophys Acta 1467(1):207-18	|AGC1 |ANT1 |CRC1 |MIR1 |SAL1 |TPC1 |UGO1 |YDL119C |YEA6 |YFR045W |YIA6 |YPR011C
Non-Fungal Related Genes/Proteins	Dyall SD, et al. (2000) Presence of a member of the mitochondrial carrier family in hydrogenosomes: conservation of membrane-targeting pathways between hydrogenosomes and mitochondria. Mol Cell Biol 20(7):2488-97	|AAC1 |PET9 |TIM10 |TIM9
Fungal Related Genes/Proteins	Fiore C, et al. (2000) Purification of histidine-tagged mitochondrial ADP/ATP carrier: influence of the conformational states of the C-terminal region. Protein Expr Purif 19(1):57-65	|AAC1 |PET9
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Kissova I, et al. (2000) The cytotoxic action of Bax on yeast cells does not require mitochondrial ADP/ATP carrier but may be related to its import to the mitochondria. FEBS Lett 471(1):113-8	|AAC1 |PET9
DNA/RNA Sequence Features Regulation of Transcription	Sokolikova B, et al. (2000) A carbon-source-responsive element is required for regulation of the hypoxic ADP/ATP carrier (AAC3) isoform in Saccharomyces cerevisiae. Biochem J 352 Pt 3():893-8	|RAP1 |ROX1
Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Strains/Constructs	Nebohacova M, et al. (1999) Isolation and expression of the gene encoding mitochondrial ADP/ATP carrier (AAC) from the pathogenic yeast Candida parapsilosis. Yeast 15(12):1237-42	|PET9
Protein Processing/Modification/Regulation Protein-protein Interactions	Ryan MT, et al. (1999) Functional staging of ADP/ATP carrier translocation across the outer mitochondrial membrane. J Biol Chem 274(29):20619-27	|AAC1 |PET9 |SAM37 |TIM10 |TOM20 |TOM40 |TOM70
RNA Levels and Processing Regulation of	ter Linde JJ, et al. (1999) Genome-wide transcriptional analysis of aerobic and anaerobic chemostat cultures of Saccharomyces cerevisiae. J Bacteriol 181(24):7409-13	|ADH2 |ADY2 |AGP1 |ANB1 |ARO10 |CIT3 |CLD1 |CTA1 |CYB2 |DAN1 |DIP5 |FDH1 |FDH2 |FET3 |MORE
DNA/RNA Sequence Features Non-Fungal Related Genes/Proteins Transcription	Giraud S, et al. (1998) Expression of human ANT2 gene in highly proliferative cells: GRBOX, a new transcriptional element, is involved in the regulation of glycolytic ATP import into mitochondria. J Mol Biol 281(3):409-18
Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Strains/Constructs	Joseph-Liauzun E, et al. (1997) The Mr 18,000 subunit of the peripheral-type benzodiazepine receptor exhibits both benzodiazepine and isoquinoline carboxamide binding sites in the absence of the voltage-dependent anion channel or of the adenine nucleotide carrier. J Biol Chem 272(44):28102-6	|AAC1 |PET9 |POR1
Cellular Location Function/Process Fungal Related Genes/Proteins Protein Physical Properties Protein Sequence Features Protein/Nucleic Acid Structure	el Moualij B, et al. (1997) Phylogenetic classification of the mitochondrial carrier family of Saccharomyces cerevisiae. Yeast 13(6):573-81	|AAC1 |AGC1 |ANT1 |CRC1 |CTP1 |DIC1 |FLX1 |GGC1 |LEU5 |MIR1 |MRS3 |MRS4 |MTM1 |OAC1 |MORE
Fungal Related Genes/Proteins	Couzin N, et al. (1996) Cloning of the gene encoding the mitochondrial adenine nucleotide carrier of Schizosaccharomyces pombe by functional complementation in Saccharomyces cerevisiae. Gene 171(1):113-7	|AAC1 |PET9
Cellular Location Function/Process Fungal Related Genes/Proteins	Gavurnikova G, et al. (1996) Transcription of the AAC1 gene encoding an isoform of mitochondrial ADP/ATP carrier in Saccharomyces cerevisiae is regulated by oxygen in a heme-independent manner. Eur J Biochem 239(3):759-63	|AAC1 |PET9
Fungal Related Genes/Proteins	Betina S, et al. (1995) Expression of the AAC2 gene encoding the major mitochondrial ADP/ATP carrier in Saccharomyces cerevisiae is controlled at the transcriptional level by oxygen, heme and HAP2 factor. Eur J Biochem 229(3):651-7	|AAC1 |ABF1 |HAP2 |HAP3 |PET9
Mapping	Song JM, et al. (1995) Nucleotide sequence and characterization of the Saccharomyces cerevisiae RPL19A gene encoding a homolog of the mammalian ribosomal protein L19. Yeast 11(4):383-9	|MIS1 |RPL19A |RPL19B
Fungal Related Genes/Proteins	Brandolin G, et al. (1993) Biochemical characterisation of the isolated Anc2 adenine nucleotide carrier from Saccharomyces cerevisiae mitochondria. Biochem Biophys Res Commun 192(1):143-50	|AAC1 |PET9
DNA/RNA Sequence Features Function/Process Mutants/Phenotypes Regulation of Strains/Constructs	Sabova L, et al. (1993) Transcriptional control of AAC3 gene encoding mitochondrial ADP/ATP translocator in Saccharomyces cerevisiae by oxygen, heme and ROX1 factor. Eur J Biochem 213(1):547-53	|ANB1 |HEM13 |ROX1
Genetic Interactions Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors	Drgon T, et al. (1992) Yeast ADP/ATP carrier (AAC) proteins exhibit similar enzymatic properties but their deletion produces different phenotypes. FEBS Lett 304(2-3):277-80	|AAC1 |PET9
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Drgon T, et al. (1991) ADP/ATP translocator is essential only for anaerobic growth of yeast Saccharomyces cerevisiae. FEBS Lett 289(2):159-62	|AAC1 |PET9
Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes RNA Levels and Processing Regulation of Strains/Constructs	Kolarov J, et al. (1990) A third ADP/ATP translocator gene in yeast. J Biol Chem 265(21):12711-6	|AAC1 |PET9

Return to SGD

Send a Message to the SGD Curators