---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

CSG2/YBR036C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrII: 310313 to 309081 CDS: 310313 - 309081 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
CSG2	YBR036C	CLS2	ORF, Verified	S000000240
Description
Endoplasmic reticulum membrane protein, required for mannosylation of inositolphosphorylceramide and for growth at high calcium concentrations

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By enzyme regulator activity Uemura S, et al. (2003) Csg1p and newly identified Csh1p function in mannosylinositol phosphorylceramide synthesis by interacting with Csg2p. J Biol Chem 278(46):45049-55        IPI : Inferred from Physical Interaction IMP : Inferred from Mutant Phenotype Assigned on 2004-01-02 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By cellular calcium ion homeostasis Takita Y, et al. (1995) The CLS2 gene encodes a protein with multiple membrane-spanning domains that is important Ca2+ tolerance in yeast. Mol Gen Genet 246(3):269-81      IMP : Inferred from Mutant Phenotype Assigned on 2002-09-06 SGD cellular lipid metabolic process Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT glycosphingolipid biosynthetic process Zhao C, et al. (1994) Suppressors of the Ca(2+)-sensitive yeast mutant (csg2) identify genes involved in sphingolipid biosynthesis. Cloning and characterization of SCS1, a gene required for serine palmitoyltransferase activity. J Biol Chem 269(34):21480-8      ISS : Inferred from Sequence or structural Similarity Assigned on 2005-03-01 SGD response to drug Dilda PJ, et al. (2005) Mechanism of selectivity of an angiogenesis inhibitor from screening a genome-wide set of Saccharomyces cerevisiae deletion strains. J Natl Cancer Inst 97(20):1539-47                IMP : Inferred from Mutant Phenotype Assigned on 2007-01-08 SGD
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB integral to endoplasmic reticulum membrane Takita Y, et al. (1995) The CLS2 gene encodes a protein with multiple membrane-spanning domains that is important Ca2+ tolerance in yeast. Mol Gen Genet 246(3):269-81      IDA : Inferred from Direct Assay Assigned on 2002-09-06 SGD integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
sphingolipid metabolism

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for CSG2/YBR036C for CSG2 About sphingolipid metabolism Sphingolipids are essential components of the plasma membrane in all eukaryotic cells. S. cerevisiae cells make three complex sphingolipids: inositol-phosphoceramide (IPC), mannose-inositol-phosphoceramide (MIPC), and mannose-(inositol phosphate)2-ceramide (M(IP)2C)(1). In the yeast plasma membrane sphingolipids concentrate with ergosterol to form lipid rafts, specialized membrane microdomains implicated in a variety of cellular processes, including sorting of membrane proteins and lipids, as well as organizing and regulating signaling cascades (2). Intermediates in sphingolipid biosynthesis have been shown to play important roles as signaling molecules and growth regulators. Sphingolipid long chain bases (LCBs), dihydrosphingosine (DHS) and phytosphingosine (PHS), have been implicated as secondary messengers in signaling pathways that regulate heat stress response (3, 4). Other intermediates, phytoceramide and long-chain base phosphates (LCBPs), have been shown to be components of the tightly-controlled ceramide/LCBP rheostat, which regulates cell growth (5). Since phosphoinositol-containing sphingolipids are unique to fungi, the sphingolipid biosynthesis pathway is considered a target for antifungal drugs (6, 7). Last Updated: 2007-10-05

Basic References [TOP]

BASIC INFORMATION REFERENCES forCSG2/YBR036C for CSG2 1) Dickson RC and Lester RL (2002) Sphingolipid functions in Saccharomyces cerevisiae. Biochim Biophys Acta 1583(1):13-25            2) Bagnat M and Simons K (2002) Lipid rafts in protein sorting and cell polarity in budding yeast Saccharomyces cerevisiae. Biol Chem 383(10):1475-80        3) Jenkins GM, et al. (1997) Involvement of yeast sphingolipids in the heat stress response of Saccharomyces cerevisiae. J Biol Chem 272(51):32566-72        4) Ferguson-Yankey SR, et al. (2002) Mutant analysis reveals complex regulation of sphingolipid long chain base phosphates and long chain bases during heat stress in yeast. Yeast 19(7):573-86      5) Kobayashi SD and Nagiec MM (2003) Ceramide/long-chain base phosphate rheostat in Saccharomyces cerevisiae: regulation of ceramide synthesis by Elo3p and Cka2p. Eukaryot Cell 2(2):284-94        6) Nagiec MM, et al. (1997) Sphingolipid synthesis as a target for antifungal drugs. Complementation of the inositol phosphorylceramide synthase defect in a mutant strain of Saccharomyces cerevisiae by the AUR1 gene. J Biol Chem 272(15):9809-17        7) Sugimoto Y, et al. (2004) IPC synthase as a useful target for antifungal drugs. Curr Drug Targets Infect Disord 4(4):311-22        8) Tanida I, et al. (1996) Yeast Cls2p/Csg2p localized on the endoplasmic reticulum membrane regulates a non-exchangeable intracellular Ca2+ pool cooperatively with calcineurin. FEBS Lett 379(1):38-42        9) Beeler T, et al. (1994) A novel protein, CSG2p, is required for Ca2+ regulation in Saccharomyces cerevisiae. J Biol Chem 269(10):7279-84      10) Stock SD, et al. (2000) Syringomycin E inhibition of Saccharomyces cerevisiae: requirement for biosynthesis of sphingolipids with very-long-chain fatty acids and mannose- and phosphoinositol-containing head groups. Antimicrob Agents Chemother 44(5):1174-80

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for CSG2/YBR036C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for CSG2/YBR036C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MSTTLLW C-term GEGKYHH Length(aa) 410 MW(Da) 45,442 pI 7.25 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.163   Codon Adaptation Index 0.142   Frequency of Optimal Codons 0.501   Hydropathicity of Protein 0.383   Aromaticity Score 0.105

10 20 30 40 50 | | | | | MSTTLLWFSSVIGYVIQTKCLSNIQSKKEISVGPNGTIATPETNGDNGNS SSLTFYLTFMYFASWLLLVPASRLWEKMRPMFVSDSDSNRNSQFDNNNSG SVTNEDVDTFSHVLDDPQPRIPAQQQKQKIISVATFKYVAKLTVLALIMI VADLTYNMALSLSPAFDVALMQNTAIFEIVTLLYGVCGISRKNYVFRNFL IMMNAVIGILIISYTKATCDMLAGKLSVNPNTGELSDPFLFDRLKGALIC GLGALIMGPFAVLWNRWFCSNISKNENSAVVLVKQSTHMALIGIIGMVIL LPFIPKFPSRESVESISLFYNDKSFWFSLLGSIIFGSLPSLISILELNRK APAEYLTTCNLGAIIFMGLAEWVCEPTQTTIVRWEVIGYIMLTVSLLVLS VTLGEGKYHH*

Protein Structures from PDB: proteins of known structure with sequence similarity to CSG2/YBR036C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
CSG2	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YBR036C	SGD Systematic Sequence
852324	NCBI: Gene ID
NP_009592.1	NCBI: RefSeq protein version ID
NP_009592.1	NCBI: RefSeq protein version ID
6319510	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) Organelle DB (UMich) YGAC Triples YPL.db at Uni Graz YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
45 curated references; 0 references not yet curated
Mutants/Phenotypes Strains/Constructs	Roelants FM, et al. (2010) A protein kinase network regulates the function of aminophospholipid flippases. Proc Natl Acad Sci U S A 107(1):34-9	|DNF1 |DNF2 |DNF3 |FPK1 |IPT1 |KIN28 |KIN82 |PKH1 |PKH2 |TOR1 |TOR2 |YPK1 |YPK2
Disease Gene Related Reviews	Ozbayraktar FB and Ulgen KO (2009) Molecular facets of sphingolipids: mediators of diseases. Biotechnol J 4(7):1028-41	|AUR1 |CSH1 |IPT1 |ISC1 |LAC1 |LAG1 |LCB1 |LCB2 |LCB4 |LCB5 |SCS7 |SUR1 |SUR2 |TSC10 |MORE
Large-scale phenotype analysis	Tan SX, et al. (2009) Cu, Zn superoxide dismutase and NADP(H) homeostasis are required for tolerance of endoplasmic reticulum stress in Saccharomyces cerevisiae. Mol Biol Cell 20(5):1493-508	|AAT2 |ADO1 |AIM26 |ALG7 |ARO2 |BCK1 |BUR2 |CCS1 |CNB1 |CNM67 |CRZ1 |ELP2 |ERG2 |ERG6 |MORE
Genetic Interactions	Addinall SG, et al. (2008) A Genomewide Suppressor and Enhancer Analysis of cdc13-1 Reveals Varied Cellular Processes Influencing Telomere Capping in Saccharomyces cerevisiae. Genetics 180(4):2251-66	|APQ12 |ARC18 |ARV1 |ASC1 |ASE1 |BFA1 |BIM1 |BMH1 |BRE2 |BUB1 |BUB2 |BUB3 |BUD27 |CCS1 |MORE
Mutants/Phenotypes Strains/Constructs	Bockhorn J, et al. (2008) Genome-wide screen of Saccharomyces cerevisiae null allele strains identifies genes involved in selenomethionine resistance. Proc Natl Acad Sci U S A 105(46):17682-17687	|AAH1 |APQ13 |ARC18 |ARE1 |ARO7 |ASI3 |BSD2 |BUD23 |CGR1 |CYS3 |DAL3 |GRE2 |HHT2 |HMG1 |MORE
Reviews	Dickson RC (2008) Thematic Review Series: Sphingolipids. New insights into sphingolipid metabolism and function in budding yeast. J Lipid Res 49(5):909-21	|AUR1 |CSH1 |DPL1 |FEN1 |IFA38 |IPT1 |ISC1 |LCB1 |LCB2 |LCB3 |LCB4 |LCB5 |LIP1 |PHS1 |MORE
Mutants/Phenotypes	Herrero AB, et al. (2008) Levels of SCS7/FA2H-Mediated Fatty Acid 2-Hydroxylation Determine the Sensitivity of Cells to Antitumor PM02734. Cancer Res 68(23):9779-87	|AIM44 |ALD6 |ALG6 |API2 |APL1 |APL5 |APM3 |ATP15 |ATP4 |ATP5 |ATP7 |BRE5 |BST1 |CAT5 |MORE
Mutants/Phenotypes	Jin YH, et al. (2008) Global transcriptome and deletome profiles of yeast exposed to transition metals. PLoS Genet 4(4):e1000053	|ADH1 |ARN1 |ARN2 |ATM1 |ATX1 |BCK1 |BNI1 |BSD2 |BUD16 |BUD25 |CCC2 |CKA1 |CKA2 |CKB2 |MORE
Large-scale phenotype analysis Mutants/Phenotypes	Matsufuji Y, et al. (2008) Acetaldehyde tolerance in Saccharomyces cerevisiae involves the pentose phosphate pathway and oleic acid biosynthesis. Yeast 25(11):825-33	|ALD3 |ALD6 |AMD1 |ARC1 |ASC1 |BEM4 |BUD27 |CIK1 |COQ3 |ELP2 |ELP3 |GCR2 |GND1 |GSH1 |MORE
Reviews	Cowart LA and Obeid LM (2007) Yeast sphingolipids: recent developments in understanding biosynthesis, regulation, and function. Biochim Biophys Acta 1771(3):421-31	|AUR1 |CSH1 |DPL1 |FEN1 |ISC1 |LAC1 |LAG1 |LCB1 |LCB2 |LCB3 |LCB4 |LCB5 |SUR1 |SUR4 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Daquinag A, et al. (2007) The yeast PH domain proteins Slm1 and Slm2 are targets of sphingolipid signaling during the response to heat stress. Mol Cell Biol 27(2):633-50	|CNA1 |FEN1 |LCB4 |PKH1 |PKH2 |SLM1 |SLM2
Function/Process Mutants/Phenotypes Strains/Constructs	Haass FA, et al. (2007) Identification of yeast proteins necessary for cell-surface function of a potassium channel. Proc Natl Acad Sci U S A 104(46):18079-18084	|BST1 |EMP24 |ERV14 |ERV25 |SUR4 |TED1
Genetic Interactions Mutants/Phenotypes Protein Processing/Modification/Regulation Strains/Constructs	Uemura S, et al. (2007) Regulation of the Transport and Protein Levels of the Inositol Phosphorylceramide Mannosyltransferases Csg1 and Csh1 by the Ca2+-binding Protein Csg2. J Biol Chem 282(12):8613-21	|CSH1 |SUR1
Regulation of Transcription	Vemuri GN, et al. (2007) Increasing NADH oxidation reduces overflow metabolism in Saccharomyces cerevisiae. Proc Natl Acad Sci U S A 104(7):2402-7	|AAC1 |AAH1 |ADH1 |ADH2 |ADH3 |ALD4 |ALD5 |ALD6 |CIT1 |CYB2 |DAK2 |ENO1 |ERG25 |FAA2 |MORE
Transcription	Corbacho I, et al. (2006) Genome-wide expression profile of the mnn2 Delta mutant of Saccharomyces cerevisiae. Antonie Van Leeuwenhoek 89(3-4):485-94	|BNA5 |CHS3 |FIT1 |FIT2 |MNN2 |PET191 |RVS161 |RVS167 |SEC9 |SLT2 |SOR1 |SWI4 |VPS24 |VPS5 |MORE
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
RNA Levels and Processing	Guo Y, et al. (2006) Analysis of cellular responses to aflatoxin B(1) in yeast expressing human cytochrome P450 1A2 using cDNA microarrays. Mutat Res 593(1-2):121-42	|AAT1 |AHA1 |ALD2 |ALD3 |ALK1 |APC1 |APC5 |APT2 |AQR1 |AQY2 |ARC40 |ARN1 |ARO10 |ARO9 |MORE
Mutants/Phenotypes	Rand JD and Grant CM (2006) The thioredoxin system protects ribosomes against stress-induced aggregation. Mol Biol Cell 17(1):387-401	|AAT2 |ADH1 |ADK1 |AFR1 |AKR1 |ANP1 |APQ13 |ARO2 |ARP8 |ARV1 |ARX1 |ATP12 |ATP2 |BEM1 |MORE
Reviews	Riezman H (2006) Organization and functions of sphingolipid biosynthesis in yeast. Biochem Soc Trans 34(3):367-369	|AUR1 |DPL1 |IPT1 |LAC1 |LAG1 |LCB1 |LCB2 |LCB3 |LCB4 |LCB5 |LIP1 |SUR1 |SUR2 |TSC3 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Tabuchi M, et al. (2006) The phosphatidylinositol 4,5-biphosphate and TORC2 binding proteins Slm1 and Slm2 function in sphingolipid regulation. Mol Cell Biol 26(15):5861-75	|AUR1 |BCK1 |CMP2 |CNB1 |FEN1 |GAS1 |GIM3 |INO2 |INO4 |ISC1 |KRE1 |LDB16 |MSS4 |NUP133 |MORE
Mutants/Phenotypes	Dilda PJ, et al. (2005) Mechanism of selectivity of an angiogenesis inhibitor from screening a genome-wide set of Saccharomyces cerevisiae deletion strains. J Natl Cancer Inst 97(20):1539-47	|ACO1 |ADE1 |ARG82 |BRE1 |CBF1 |CCR4 |CSM1 |CYS3 |CYS4 |EAP1 |ECM25 |ELM1 |EMI2 |FIS1 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Gaigg B, et al. (2005) Synthesis of sphingolipids with very long chain fatty acids but not ergosterol is required for routing of newly synthesized plasma membrane ATPase to the cell surface of yeast. J Biol Chem 280(23):22515-22	|ACB1 |ACC1 |ARE1 |ARE2 |AYR1 |DPL1 |ELO1 |ERG24 |ERG3 |ERG4 |ERG5 |FEN1 |HEM1 |IFA38 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Kobayashi T, et al. (2005) Disturbance of sphingolipid biosynthesis abrogates the signaling of Mss4, phosphatidylinositol-4-phosphate 5-kinase, in yeast. J Biol Chem 280(18):18087-94	|IPT1 |MSS4 |PLC1 |RHO1 |RHO2 |ROM2 |SUR2
Mutants/Phenotypes Strains/Constructs	Baetz K, et al. (2004) Yeast genome-wide drug-induced haploinsufficiency screen to determine drug mode of action. Proc Natl Acad Sci U S A 101(13):4525-30	|LCB1 |LCB2 |PKH1 |SUR2 |TSC10 |YPK1
Function/Process Mutants/Phenotypes Strains/Constructs	Markovich S, et al. (2004) Genomic approach to identification of mutations affecting caspofungin susceptibility in Saccharomyces cerevisiae. Antimicrob Agents Chemother 48(10):3871-6	|BCK1 |CCR4 |CHC1 |CHS3 |CHS7 |CKA2 |ERG3 |ERG5 |ERG6 |FKS1 |ILM1 |MID2 |MNN10 |NPL3 |MORE
Genetic Interactions Strains/Constructs	Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13	|AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Tomishige N, et al. (2003) Mutations that are synthetically lethal with a gas1Delta allele cause defects in the cell wall of Saccharomyces cerevisiae. Mol Genet Genomics 269(4):562-73	|BIG1 |GAS1 |IPT1 |KEX2 |KRE6 |MKC7 |SLG1 |YPS1
Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Uemura S, et al. (2003) Csg1p and newly identified Csh1p function in mannosylinositol phosphorylceramide synthesis by interacting with Csg2p. J Biol Chem 278(46):45049-55	|CSH1 |IPT1 |SCS7 |SUR1 |SUR2
Reviews	Bagnat M and Simons K (2002) Lipid rafts in protein sorting and cell polarity in budding yeast Saccharomyces cerevisiae. Biol Chem 383(10):1475-80	|AUR1 |IPT1 |LAC1 |LAG1 |LCB1 |LCB2 |LCB3 |LCB4 |LCB5 |SUR1 |SUR2 |TSC10 |YSR3
Reviews	Funato K, et al. (2002) Biosynthesis and trafficking of sphingolipids in the yeast Saccharomyces cerevisiae. Biochemistry 41(51):15105-14	|ACB1 |AUR1 |CCC2 |DPL1 |ELO1 |FEN1 |FMP45 |IFA38 |IPT1 |ISC1 |LAC1 |LAG1 |LCB1 |LCB2 |MORE
Function/Process Reviews	Obeid LM, et al. (2002) Yeast sphingolipids: metabolism and biology. Biochim Biophys Acta 1585(2-3):163-71	|FEN1 |LCB4 |LCB5 |SUR1 |SUR2 |SUR4
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Kohlwein SD, et al. (2001) Tsc13p is required for fatty acid elongation and localizes to a novel structure at the nuclear-vacuolar interface in Saccharomyces cerevisiae. Mol Cell Biol 21(1):109-25	|FEN1 |SUR4 |TSC13
Function/Process Mutants/Phenotypes Other Features Strains/Constructs	Stock SD, et al. (2000) Syringomycin E inhibition of Saccharomyces cerevisiae: requirement for biosynthesis of sphingolipids with very-long-chain fatty acids and mannose- and phosphoinositol-containing head groups. Antimicrob Agents Chemother 44(5):1174-80	|FEN1 |IPT1 |SEC14 |SUR1 |SUR4
Alias Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein Sequence Features Regulatory Role Reviews Strains/Constructs	Dickson RC and Lester RL (1999) Metabolism and selected functions of sphingolipids in the yeast Saccharomyces cerevisiae. Biochim Biophys Acta 1438(3):305-21	|AUR1 |DPL1 |ERG2 |FAS2 |FEN1 |IPT1 |LCB1 |LCB2 |LCB3 |LCB4 |LCB5 |MSN2 |MSN4 |MSS4 |MORE
Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes	Beeler T, et al. (1998) The Saccharomyces cerevisiae TSC10/YBR265w gene encoding 3-ketosphinganine reductase is identified in a screen for temperature-sensitive suppressors of the Ca2+-sensitive csg2Delta mutant. J Biol Chem 273(46):30688-94	|FAS2 |LCB1 |LCB2 |MSS4 |RPD3 |SIN3 |SUR2 |TOR2 |TSC10 |TSC11 |TSC13 |TSC3
Reviews	Daum G, et al. (1998) Biochemistry, cell biology and molecular biology of lipids of Saccharomyces cerevisiae. Yeast 14(16):1471-510	|ACC1 |ACP1 |AUR1 |CDS1 |CEM1 |CHO1 |CHO2 |CKI1 |CPT1 |CRD1 |DPL1 |DPP1 |EPT1 |ERG1 |MORE
Reviews	Dickson RC (1998) Sphingolipid functions in Saccharomyces cerevisiae: comparison to mammals. Annu Rev Biochem 67:27-48	|DPL1 |IPT1 |LCB1 |LCB2 |LCB3 |SAC1 |SUR2
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Dunn TM, et al. (1998) Synthesis of monohydroxylated inositolphosphorylceramide (IPC-C) in Saccharomyces cerevisiae requires Scs7p, a protein with both a cytochrome b5-like domain and a hydroxylase/desaturase domain. Yeast 14(4):311-21	|SCS7 |SUR1
Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Regulatory Role	Beeler TJ, et al. (1997) SUR1 (CSG1/BCL21), a gene necessary for growth of Saccharomyces cerevisiae in the presence of high Ca2+ concentrations at 37 degrees C, is required for mannosylation of inositolphosphorylceramide. Mol Gen Genet 255(6):570-9	|CCC2 |CSH1 |OCH1 |PLC1 |SUR1
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Haak D, et al. (1997) Hydroxylation of Saccharomyces cerevisiae ceramides requires Sur2p and Scs7p. J Biol Chem 272(47):29704-10	|SCS7 |SUR1 |SUR2
Alias Genetic Interactions Mutants/Phenotypes Strains/Constructs	Tanida I, et al. (1996) Yeast Cls2p/Csg2p localized on the endoplasmic reticulum membrane regulates a non-exchangeable intracellular Ca2+ pool cooperatively with calcineurin. FEBS Lett 379(1):38-42	|CUP5
Alias Cellular Location DNA/RNA Sequence Features Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs Techniques and Reagents	Takita Y, et al. (1995) The CLS2 gene encodes a protein with multiple membrane-spanning domains that is important Ca2+ tolerance in yeast. Mol Gen Genet 246(3):269-81	|RVS161 |SUR1
DNA/RNA Sequence Features Function/Process Mutants/Phenotypes Protein Processing/Modification/Regulation Protein Sequence Features Strains/Constructs	Beeler T, et al. (1994) A novel protein, CSG2p, is required for Ca2+ regulation in Saccharomyces cerevisiae. J Biol Chem 269(10):7279-84	|SUR1
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Zhao C, et al. (1994) Suppressors of the Ca(2+)-sensitive yeast mutant (csg2) identify genes involved in sphingolipid biosynthesis. Cloning and characterization of SCS1, a gene required for serine palmitoyltransferase activity. J Biol Chem 269(34):21480-8	|LCB1 |LCB2 |SCS7
Alias Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Strains/Constructs	Ohya Y, et al. (1986) Isolation and characterization of Ca2+-sensitive mutants of Saccharomyces cerevisiae. J Gen Microbiol 132(4):979-88	|CDC24 |CLS1 |CUP5 |HOM3 |TFP1 |TFP3 |URA3 |VMA13 |VPH2 |VPS33

Return to SGD

Send a Message to the SGD Curators