---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

FUR4/YBR021W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrII: 281443 to 283344 CDS: 281443 - 283344 Genetic position: 8 cM Genetic Map Data Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
FUR4	YBR021W		ORF, Verified	S000000225
Description
Uracil permease, localized to the plasma membrane; expression is tightly regulated by uracil levels and environmental cues

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By nucleobase transmembrane transporter activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001248 , EBI:IPR012681 Assigned on 2007-05-23 UniProtKB uracil:cation symporter activity Urban-Grimal D, et al. (1995) Replacement of Lys by Glu in a transmembrane segment strongly impairs the function of the uracil permease from Saccharomyces cerevisiae. Biochem J 308 ( Pt 3)():847-51      IDA : Inferred from Direct Assay Assigned on 2002-09-20 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By nucleobase, nucleoside, nucleotide and nucleic acid transport DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001248 , EBI:IPR012681 Assigned on 2007-05-23 UniProtKB transmembrane transport Urban-Grimal D, et al. (1995) Replacement of Lys by Glu in a transmembrane segment strongly impairs the function of the uracil permease from Saccharomyces cerevisiae. Biochem J 308 ( Pt 3)():847-51      IDA : Inferred from Direct Assay Assigned on 2008-12-09 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR012681 , EBI:IPR001248 Assigned on 2009-10-01 UniProtKB transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB uracil transport Urban-Grimal D, et al. (1995) Replacement of Lys by Glu in a transmembrane segment strongly impairs the function of the uracil permease from Saccharomyces cerevisiae. Biochem J 308 ( Pt 3)():847-51      IDA : Inferred from Direct Assay Assigned on 2002-09-20 SGD
Cellular Component Annotation(s) Reference(s) Evidence Assigned By integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR012681 , EBI:IPR001248 Assigned on 2009-06-17 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2009-06-29 UniProtKB membrane raft Malinska K, et al. (2004) Distribution of Can1p into stable domains reflects lateral protein segregation within the plasma membrane of living S. cerevisiae cells. J Cell Sci 117(Pt 25):6031-41        IDA : Inferred from Direct Assay Assigned on 2004-12-15 SGD plasma membrane Urban-Grimal D, et al. (1995) Replacement of Lys by Glu in a transmembrane segment strongly impairs the function of the uracil permease from Saccharomyces cerevisiae. Biochem J 308 ( Pt 3)():847-51      IDA : Inferred from Direct Assay Assigned on 2002-09-20 SGD

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for FUR4/YBR021W for FUR4 Fur4p is a uracil permease that mediates the uptake of uracil, but does not transport other natural pyrimidines such as cytosine, thymine, or uridine (1, 2). It is localized to lipid microdomains of the plasma membrane that also contain Can1p and Sur7p (3) Fur4p functions as a symporter by actively translocating uracil with the co-transport of protons (4). Since the magnitude of the proton gradient across the plasma membrane influences the rate of uracil uptake by Fur4p, the rate fluctuates with varying ionic conditions (5). The prodrug 5-fluorouracil (5-FU) also enters the cell via Fur4p (1), and the immunosuppressant leflunomide inhibits Fur4p-mediated uracil uptake (6). Fur4p abundance is an important determinant of intracellular uracil levels, and is therefore under several types of regulation. FUR4 transcription is induced in response to galactose, in a GAL4-dependent manner (7). Fur4p expression is downregulated in the presence of uracil (of either exogenous or catabolic origin) in order to prevent the accumulation of excess intracellular uracil-derived nucleotides (8, 9). FUR4 mRNA is of low abundance and has a high turnover rate, with a half-life of approximately 2 minutes (10, 2). Its abundance is further decreased in response to uracil, probably due to increased degradation (9). Newly synthesized Fur4p is normally delivered to the cell surface via the secretory pathway. However in the presence of excess uracil, newly synthesized Fur4p can be directed to the degradative vacuolar pathway without ever passing through the plasma membrane (8). Normal degradation of Fur4p occurs through phosphorylation of Fur4p at the plasma membrane, followed by ubiquitination, endocytosis, and finally degradation in the vacuoles. Fur4p is phosphorylated at several serine residues within a well characterized N-terminal PEST sequence (11, 12, 10, 13,), and phosphorylation is dependent on Yck1p and Yck2p, which are serine/threonine kinases (11). Phosphorylation in turn facilitates ubiquitination of Fur4p, which occurs on lysine residues 38 and 41 and is dependent on the Rsp5p ubiquitin-protein ligase (11, 14, 15). Fur4p is then internalized and following endocytosis, is targeted to the vacuole for proteolysis (11, 16, 14). Endocytosis of Fur4p involves End3p and Sla2p functions, and degradation of Fur4p in vacuoles requires the function of Pep4p (17). Cells lacking functional ESCRT complexes (stp22, srn2, vps28, snf8, vps25, vps36, vps20, and vps24 null mutants) accumulate Fur4p at the plasma membrane (18). Uracil also promotes the normal degradation of Fur4p located in the plasma membrane (8, 9, 17). Fur4p is constitutively degraded in exponentially growing cells, and degradation increases in response to adverse conditions such as nutrient starvation, inhibition of protein synthesis, heat shock, or stationary phase (12, 17, 13). FUR4 is not essential for normal growth of uracil-proficient S. cerevisiae strains (19). fur4 mutants cannot take up uracil and are resistant to 5-fluorouracil (2, 4). Conversely, in cells overexpressing Fur4p, uracil is toxic (20, 8). fur4-[R294A] mutant protein is stabilized compared to wild-type protein during nitrogen starvation or inhibition of protein synthesis (13). FUR4 has similarity to DAL4, FUI1 and THI7, YOR071C, and Schizosaccharomyces pombe fur4 (21, 22, 12, 23, 24). Fur4p can complement the defects of an S. pombe mutant lacking uracil transport activity (25). Last Updated: 2005-12-16

Basic References [TOP]

BASIC INFORMATION REFERENCES forFUR4/YBR021W for FUR4 1) Kurtz JE, et al. (1999) New insights into the pyrimidine salvage pathway of Saccharomyces cerevisiae: requirement of six genes for cytidine metabolism. Curr Genet 36(3):130-6        2) Chevallier MR (1982) Cloning and transcriptional control of a eucaryotic permease gene. Mol Cell Biol 2(8):977-84      3) Malinska K, et al. (2004) Distribution of Can1p into stable domains reflects lateral protein segregation within the plasma membrane of living S. cerevisiae cells. J Cell Sci 117(Pt 25):6031-41        4) Urban-Grimal D, et al. (1995) Replacement of Lys by Glu in a transmembrane segment strongly impairs the function of the uracil permease from Saccharomyces cerevisiae. Biochem J 308 ( Pt 3)():847-51      5) Eddy AA and Hopkins P (1998) Proton stoichiometry of the overexpressed uracil symport of the yeast Saccharomyces cerevisiae. Biochem J 336 ( Pt 1)():125-30        6) Fujimura H (1998) Growth inhibition of Saccharomyces cerevisiae by the immunosuppressant leflunomide is due to the inhibition of uracil uptake via Fur4p. Mol Gen Genet 260(1):102-7      7) Ren B, et al. (2000) Genome-wide location and function of DNA binding proteins. Science 290(5500):2306-9              8) Blondel MO, et al. (2004) Direct sorting of the yeast uracil permease to the endosomal system is controlled by uracil binding and Rsp5p-dependent ubiquitylation. Mol Biol Cell 15(2):883-95        9) Seron K, et al. (1999) Uracil-induced down-regulation of the yeast uracil permease. J Bacteriol 181(6):1793-800        10) Volland C, et al. (1992) In vivo phosphorylation of the yeast uracil permease. J Biol Chem 267(33):23767-71      11) Marchal C, et al. (2000) Casein kinase I-dependent phosphorylation within a PEST sequence and ubiquitination at nearby lysines signal endocytosis of yeast uracil permease. J Biol Chem 275(31):23608-14        12) Marchal C, et al. (1998) A PEST-like sequence mediates phosphorylation and efficient ubiquitination of yeast uracil permease. Mol Cell Biol 18(1):314-21        13) Galan JM, et al. (1994) The yeast plasma membrane uracil permease is stabilized against stress induced degradation by a point mutation in a cyclin-like "destruction box". Biochem Biophys Res Commun 201(2):769-75      14) Galan JM and Haguenauer-Tsapis R (1997) Ubiquitin lys63 is involved in ubiquitination of a yeast plasma membrane protein. EMBO J 16(19):5847-54        15) Hein C, et al. (1995) NPl1, an essential yeast gene involved in induced degradation of Gap1 and Fur4 permeases, encodes the Rsp5 ubiquitin-protein ligase. Mol Microbiol 18(1):77-87      16) Galan JM, et al. (1996) Ubiquitination mediated by the Npi1p/Rsp5p ubiquitin-protein ligase is required for endocytosis of the yeast uracil permease. J Biol Chem 271(18):10946-52        17) Volland C, et al. (1994) Endocytosis and degradation of the yeast uracil permease under adverse conditions. J Biol Chem 269(13):9833-41      18) Bugnicourt A, et al. (2004) Antagonistic roles of ESCRT and Vps class C/HOPS complexes in the recycling of yeast membrane proteins. Mol Biol Cell 15(9):4203-14        19) Jund R, et al. (1988) Primary structure of the uracil transport protein of Saccharomyces cerevisiae. Eur J Biochem 171(1-2):417-24      20) Silve S, et al. (1991) Membrane insertion of uracil permease, a polytopic yeast plasma membrane protein. Mol Cell Biol 11(2):1114-24      21) de Montigny J, et al. (1998) The uracil permease of Schizosaccharomyces pombe: a representative of a family of 10 transmembrane helix transporter proteins of yeasts. Yeast 14(11):1051-9        22) De Wergifosse P, et al. (1994) The sequence of a 22.4 kb DNA fragment from the left arm of yeast chromosome II reveals homologues to bacterial proline synthetase and murine alpha-adaptin, as well as a new permease and a DNA-binding protein. Yeast 10(11):1489-96      23) Wagner R, et al. (1998) The ORF YBL042 of Saccharomyces cerevisiae encodes a uridine permease. FEMS Microbiol Lett 159(1):69-75        24) Yoo HS, et al. (1992) The allantoin and uracil permease gene sequences of Saccharomyces cerevisiae are nearly identical. Yeast 8(12):997-1006      25) Chevallier MR and Lacroute F (1982) Expression of the cloned uracil permease gene of Saccharomyces cerevisiae in a heterologous membrane. EMBO J 1(3):375-7      26) Pinson B, et al. (1999) Only one of the charged amino acids located in membrane-spanning regions is important for the function of the Saccharomyces cerevisiae uracil permease. Biochem J 339 ( Pt 1)():37-42        27) Hearn JD, et al. (2003) The uracil transporter Fur4p associates with lipid rafts. J Biol Chem 278(6):3679-86        28) Jund R and Lacroute F (1970) Genetic and physiological aspects of resistance to 5-fluoropyrimidines in Saccharomyces cerevisiae. J Bacteriol 102(3):607-15

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for FUR4/YBR021W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for FUR4/YBR021W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MPDNLSL C-term EHEKTFI Length(aa) 633 MW(Da) 71,735 pI 7.86 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.182   Codon Adaptation Index 0.186   Frequency of Optimal Codons 0.513   Hydropathicity of Protein 0.235   Aromaticity Score 0.164

10 20 30 40 50 | | | | | MPDNLSLHLSGSSKRLNSRQLMESSNETFAPNNVDLEKEYKSSQSNITTE VYEASSFEEKVSSEKPQYSSFWKKIYYEYVVVDKSILGVSILDSFMYNQD LKPVEKERRVWSWYNYCYFWLAECFNINTWQIAATGLQLGLNWWQCWITI WIGYGFVGAFVVLASRVGSAYHLSFPISSRASFGIFFSLWPVINRVVMAI VWYSVQAYIAATPVSLMLKSIFGKDLQDKIPDHFGSPNATTYEFMCFFIF WAASLPFLLVPPHKIRHLFTVKAVLVPFASFGFLIWAIRRAHGRIALGSL TDVQPHGSAFSWAFLRSLMGCMANFSTMVINAPDFSRFSKNPNSALWSQL VCIPFLFSITCLIGILVTAAGYEIYGINYWSPLDVLEKFLQTTYNKGTRA GVFLISFVFAVAQLGTNISANSLSCGTDMSAIFPKFINIKRGSLFCAAMA LCICPWNLMATSSKFTMALSAYAIFLSSIAGVVCSDYFVVRRGYIKLTHI YSHQKGSFYMYGNRFGINWRALAAYLCGVAPCLPGFIAEVGAPAIKVSDG AMKLYYLSYWVGYGLSFSSYTALCYFFPVPGCPVNNIIKDKGWFQRWANV DDFEEEWKDTIERDDLVDDNISVYEHEHEKTFI*

Protein Structures from PDB: proteins of known structure with sequence similarity to FUR4/YBR021W, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to FUR4 Homolog Source (per PDB) Protein Alignment: FUR4 vs. Homolog External Links P-Value %Identical %Similar Alignment 2jlo ( Chain: A) Structure of mhp1, a nucleobase-cation-symport-1 family transporter, in a closed conformation with benzylhydantoin PDB_Info PDB_Structure Microbacterium liquefaciens 4.4e-17 24 31 View alignment SCOP MMDB CATH 2jln ( Chain: A) Structure of mhp1, a nucleobase-cation-symport-1 family transporter PDB_Info PDB_Structure Microbacterium liquefaciens 4.4e-17 24 31 View alignment SCOP MMDB CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
FUR4	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YBR021W	SGD Systematic Sequence
852309	NCBI: Gene ID
NP_009577.1	NCBI: RefSeq protein version ID
NP_009577.1	NCBI: RefSeq protein version ID
6319495	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
78 curated references; 0 references not yet curated
Transcription	Ferreira ME, et al. (2009) Activator-binding domains of the SWI/SNF chromatin remodeling complex characterized in vitro are required for its recruitment to promoters in vivo. FEBS J 276(9):2557-65	|GAL1 |GAL10 |GAL2 |GAL3 |GAL7 |GAL80 |GCY1 |MTH1 |PCL10 |PGM2 |SNF2 |SNF5 |SWI1
Evolution Fungal Related Genes/Proteins	Hamari Z, et al. (2009) Convergent evolution and orphan genes in the Fur4p-like family and characterization of a general nucleoside transporter in Aspergillus nidulans. Mol Microbiol 73(1):43-57	|DAL4 |FCY2 |FCY21 |FCY22 |FUI1 |FUN26 |NRT1 |THI7 |THI72 |TPN1
Mutants/Phenotypes Strains/Constructs	Hontz RD, et al. (2009) Genetic Identification of Factors That Modulate Ribosomal DNA Transcription in Saccharomyces cerevisiae. Genetics 182(1):105-19	|AAP1 |ADA2 |AGC1 |ATG2 |BNI4 |BRE1 |CHD1 |CHS6 |CIN1 |CMP2 |DAS2 |DPB11 |ECM29 |GAP1 |MORE
Mutants/Phenotypes Strains/Constructs	Jensen LT, et al. (2009) Down-regulation of a manganese transporter in the face of metal toxicity. Mol Biol Cell 20(12):2810-9	|BSD2 |PMR1 |RSP5 |SMF1 |SMF2 |TAT2 |TRE1 |TRE2
Cellular Location Protein Processing/Modification/Regulation Regulation of	Lam MH, et al. (2009) Interaction of the Deubiquitinating Enzyme Ubp2 and the E3 Ligase Rsp5 Is Required for Transporter/Receptor Sorting in the Multivesicular Body Pathway. PLoS ONE 4(1):e4259	|RSP5 |RUP1 |SRN2 |STE2 |UBP10 |UBP2
Cellular Location Regulation of	Nikko E and Pelham HR (2009) Arrestin-mediated endocytosis of yeast plasma membrane transporters. Traffic 10(12):1856-67	|ALY1 |ALY2 |ART10 |ART5 |BSD2 |BUL1 |BUL2 |CSR2 |EAR1 |ECM21 |HXT6 |ITR1 |LDB19 |PIB1 |MORE
Reviews	Belgareh-Touze N, et al. (2008) Versatile role of the yeast ubiquitin ligase Rsp5p in intracellular trafficking. Biochem Soc Trans 36(Pt 5):791-6	|BSD2 |BUL1 |BUL2 |CPS1 |EAR1 |GAP1 |PPN1 |RSP5 |SIT1 |SMF1 |SNA3 |SSH4 |TAT2 |TRE1 |MORE
Reviews	Fujita M and Jigami Y (2008) Lipid remodeling of GPI-anchored proteins and its function. Biochim Biophys Acta 1780(3):410-20	|BST1 |CDC42 |CWH43 |EGT2 |EMP24 |ERI1 |ERV25 |GAS1 |GPI10 |GUP1 |GWT1 |IRE1 |LAS21 |MCD4 |MORE
Protein Processing/Modification/Regulation Regulation of	Grossmann G, et al. (2008) Plasma membrane microdomains regulate turnover of transport proteins in yeast. J Cell Biol 183(6):1075-88	|CAN1 |CAX4 |COG1 |ELP6 |ERG2 |ERG24 |ERG5 |ERG6 |FYV6 |GOS1 |HNT3 |MDG1 |MNN10 |MNN11 |MORE
Cellular Location Strains/Constructs	Leon S, et al. (2008) Ear1p and ssh4p are new adaptors of the ubiquitin ligase rsp5p for cargo ubiquitylation and sorting at multivesicular bodies. Mol Biol Cell 19(6):2379-88	|EAR1 |GAP1 |PPN1 |RSP5 |SIT1 |SMF1 |SSH4
Cellular Location Protein Processing/Modification/Regulation Regulation of Strains/Constructs Substrates/Ligands/Cofactors	Pineau L, et al. (2008) A Lipid-mediated Quality Control Process in the Golgi Apparatus in Yeast. Mol Biol Cell 19(3):807-21	|END3 |HEM1 |RSP5 |SEC7
Mutants/Phenotypes Strains/Constructs	Ruotolo R, et al. (2008) Membrane transporters and protein traffic networks differentially affecting metal tolerance: a genomic phenotyping study in yeast. Genome Biol 9(4):R67	|AAT2 |AFT1 |ALF1 |APL5 |APL6 |APM3 |APS3 |ARO2 |BCK1 |BUB3 |CCC2 |CCR4 |CDC10 |CLC1 |MORE
Mutants/Phenotypes	Fairn GD, et al. (2007) A chemogenomic screen in Saccharomyces cerevisiae uncovers a primary role for the mitochondria in farnesol toxicity and its regulation by the Pkc1 pathway. J Biol Chem 282(7):4868-74	|AIM21 |ARG4 |BCK1 |CBP1 |CLA4 |COR1 |COX11 |DAL5 |ECM33 |EOS1 |ERG6 |FSF1 |FUI1 |FYV6 |MORE
Cellular Location Protein Processing/Modification/Regulation Strains/Constructs	Gabriely G, et al. (2007) Involvement of Specific COPI Subunits in Protein Sorting from the Late Endosome to the Vacuole in Yeast. Mol Cell Biol 27(2):526-40	|COP1 |CPS1 |PRC1 |SEC21 |SEC27 |SEC28 |STE2 |STE3 |VPS27
Cellular Location Strains/Constructs	Grossmann G, et al. (2007) Membrane potential governs lateral segregation of plasma membrane proteins and lipids in yeast. EMBO J 26(1):1-8	|ATP1 |CAN1 |COX7 |HXT1 |PIL1 |PMA1 |SUR7 |TAT2
Cellular Location	Kama R, et al. (2007) Btn2, a hook1 ortholog and potential batten disease-related protein, mediates late endosome-Golgi protein sorting in yeast. Mol Cell Biol 27(2):605-21	|BTN2 |PEP1 |PEP8 |RHB1 |SEC7 |SED5 |SNC1 |SNC2 |SNX4 |STE2 |TLG1 |TLG2 |VPS27 |VPS35 |MORE
Fungal Related Genes/Proteins Reviews	Pantazopoulou A and Diallinas G (2007) Fungal nucleobase transporters. FEMS Microbiol Rev 31(6):657-75	|FCY2
Cellular Location Strains/Constructs	Perez-Valle J, et al. (2007) Key role for intracellular k+ and protein kinases sat4/hal4 and hal5 in the plasma membrane stabilization of yeast nutrient transporters. Mol Cell Biol 27(16):5725-36	|CAN1 |HAL5 |HXT1 |PMA1 |RPS5 |SAT4 |SUR7 |TRK1 |TRK2
Cellular Location Protein Processing/Modification/Regulation Regulation of	Bultynck G, et al. (2006) Slm1 and slm2 are novel substrates of the calcineurin phosphatase required for heat stress-induced endocytosis of the yeast uracil permease. Mol Cell Biol 26(12):4729-45	|CMP2 |CNA1 |CNB1 |SLM1 |SLM2
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Okamoto M, et al. (2006) Glycosylphosphatidylinositol-anchored proteins are required for the transport of detergent-resistant microdomain-associated membrane proteins Tat2p and Fur4p. J Biol Chem 281(7):4013-23	|BUL1 |EAF3 |ERG6 |GWT1 |SSB1 |TAT2 |UBP5 |YDR266C
Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Substrates/Ligands/Cofactors	Paluszynski JP, et al. (2006) Various cytosine/adenine permease homologues are involved in the toxicity of 5-fluorocytosine in Saccharomyces cerevisiae. Yeast 23(9):707-15	|DAL4 |FCY1 |FCY2 |FCY21 |FCY22 |FUI1 |NRT1 |TPN1
Mutants/Phenotypes Strains/Constructs	Zhang J, et al. (2006) Characterization of the transport mechanism and permeant binding profile of the uridine permease Fui1p of Saccharomyces cerevisiae. J Biol Chem 281(38):28210-21	|FUI1
Cellular Location Genetic Interactions Mutants/Phenotypes Protein Processing/Modification/Regulation Strains/Constructs	Blondel MO, et al. (2004) Direct sorting of the yeast uracil permease to the endosomal system is controlled by uracil binding and Rsp5p-dependent ubiquitylation. Mol Biol Cell 15(2):883-95	|END3 |FUI1 |PEP12 |PEP4 |RSP5
Cellular Location Genetic Interactions Mutants/Phenotypes Protein Processing/Modification/Regulation Strains/Constructs	Bugnicourt A, et al. (2004) Antagonistic roles of ESCRT and Vps class C/HOPS complexes in the recycling of yeast membrane proteins. Mol Biol Cell 15(9):4203-14	|SNC1 |SNF8 |SRN2 |STP22 |VPS20 |VPS24 |VPS25 |VPS28 |VPS36
Cellular Location Strains/Constructs	Malinska K, et al. (2004) Distribution of Can1p into stable domains reflects lateral protein segregation within the plasma membrane of living S. cerevisiae cells. J Cell Sci 117(Pt 25):6031-41	|CAN1 |PMA1 |SUR7
Cellular Location Protein Processing/Modification/Regulation	Dupre S and Haguenauer-Tsapis R (2003) Raft partitioning of the yeast uracil permease during trafficking along the endocytic pathway. Traffic 4(2):83-96	|LCB1 |SNC1
Cellular Location Function/Process Regulation of	Hearn JD, et al. (2003) The uracil transporter Fur4p associates with lipid rafts. J Biol Chem 278(6):3679-86	|LCB1
Cellular Location Protein Processing/Modification/Regulation	Belgareh-Touze N, et al. (2002) Yeast Vps55p, a functional homolog of human obesity receptor gene-related protein, is involved in late endosome to vacuole trafficking. Mol Biol Cell 13(5):1694-708	|SEC7 |VPS55
Function/Process Protein Physical Properties Protein Processing/Modification/Regulation Regulation of Techniques and Reagents	Marchal C, et al. (2002) Casein kinase I controls a late step in the endocytic trafficking of yeast uracil permease. J Cell Sci 115(Pt 1):217-26	|PEP12 |YCK1 |YCK2
Function/Process Regulation of	Springael JY, et al. (2002) Yeast Npi3/Bro1 is involved in ubiquitin-dependent control of permease trafficking. FEBS Lett 517(1-3):103-9	|BRO1 |BUL1 |BUL2 |DOA4 |GAP1 |HXT6 |HXT7 |NPR1 |RSP5
Protein Physical Properties Protein Processing/Modification/Regulation Protein Sequence Features	Dupre S and Haguenauer-Tsapis R (2001) Deubiquitination step in the endocytic pathway of yeast plasma membrane proteins: crucial role of Doa4p ubiquitin isopeptidase. Mol Cell Biol 21(14):4482-94	|DOA4 |PEP4 |RSP5 |VPS27
Cellular Location	Gajewska B, et al. (2001) WW domains of Rsp5p define different functions: determination of roles in fluid phase and uracil permease endocytosis in Saccharomyces cerevisiae. Genetics 157(1):91-101	|RSP5
Function/Process Reviews	Vickers MF, et al. (2001) Functional production of mammalian concentrative nucleoside transporters in Saccharomyces cerevisiae. Mol Membr Biol 18(1):73-9	|FUI1
Cellular Location Protein Processing/Modification/Regulation Regulation of	Wang G, et al. (2001) Localization of the Rsp5p ubiquitin-protein ligase at multiple sites within the endocytic pathway. Mol Cell Biol 21(10):3564-75	|PEP12 |RSP5 |SLA2 |SNF7
Mutants/Phenotypes Protein Processing/Modification/Regulation Protein Sequence Features Strains/Constructs	Marchal C, et al. (2000) Casein kinase I-dependent phosphorylation within a PEST sequence and ubiquitination at nearby lysines signal endocytosis of yeast uracil permease. J Biol Chem 275(31):23608-14	|YCK1 |YCK2
Regulation of	Ren B, et al. (2000) Genome-wide location and function of DNA binding proteins. Science 290(5500):2306-9	|AFI1 |AGA1 |CHS1 |CIK1 |ERG24 |FAR1 |FIG1 |FIG2 |FUS1 |FUS3 |GAL1 |GAL10 |GAL2 |GAL3 |MORE
Cellular Location Protein Processing/Modification/Regulation Reviews	Rotin D, et al. (2000) Ubiquitination and endocytosis of plasma membrane proteins: role of Nedd4/Rsp5p family of ubiquitin-protein ligases. J Membr Biol 176(1):1-17	|DAL5 |FUI1 |GAL2 |GAP1 |GNP1 |HXT6 |HXT7 |ITR1 |MAL11 |MAL61 |PDR5 |PUT4 |RSP5 |STE2 |MORE
Reviews	ter Schure EG, et al. (2000) The role of ammonia metabolism in nitrogen catabolite repression in Saccharomyces cerevisiae. FEMS Microbiol Rev 24(1):67-83	|ASP3-1 |ASP3-2 |ASP3-3 |ASP3-4 |BAS1 |CAN1 |CAR1 |DAL1 |DAL2 |DAL4 |DAL7 |DAL80 |DSD1 |GAP1 |MORE
Cellular Location Function/Process Mutants/Phenotypes Protein Sequence Features Strains/Constructs Substrates/Ligands/Cofactors	Pinson B, et al. (1999) Only one of the charged amino acids located in membrane-spanning regions is important for the function of the Saccharomyces cerevisiae uracil permease. Biochem J 339 ( Pt 1)():37-42	|FUI1
Function/Process Protein Processing/Modification/Regulation RNA Levels and Processing Regulation of	Seron K, et al. (1999) Uracil-induced down-regulation of the yeast uracil permease. J Bacteriol 181(6):1793-800
Function/Process Protein Physical Properties Substrates/Ligands/Cofactors	Eddy AA and Hopkins P (1998) Proton stoichiometry of the overexpressed uracil symport of the yeast Saccharomyces cerevisiae. Biochem J 336 ( Pt 1)():125-30
Strains/Constructs	Fujimura H (1998) Growth inhibition of Saccharomyces cerevisiae by the immunosuppressant leflunomide is due to the inhibition of uracil uptake via Fur4p. Mol Gen Genet 260(1):102-7	|URA3
Mutants/Phenotypes Protein Processing/Modification/Regulation Regulation of	Galan JM, et al. (1998) 'ER degradation' of a mutant yeast plasma membrane protein by the ubiquitin-proteasome pathway. FASEB J 12(3):315-23	|RSP5 |UBC6 |UBC7
Protein Processing/Modification/Regulation Protein Sequence Features	Marchal C, et al. (1998) A PEST-like sequence mediates phosphorylation and efficient ubiquitination of yeast uracil permease. Mol Cell Biol 18(1):314-21
Cellular Location Protein Processing/Modification/Regulation	Seron K, et al. (1998) A yeast t-SNARE involved in endocytosis. Mol Biol Cell 9(10):2873-89	|SEC7 |TLG2 |VMA2
Fungal Related Genes/Proteins	Wagner R, et al. (1998) The ORF YBL042 of Saccharomyces cerevisiae encodes a uridine permease. FEMS Microbiol Lett 159(1):69-75	|DAL4 |FUI1
Fungal Related Genes/Proteins Protein Sequence Features	de Montigny J, et al. (1998) The uracil permease of Schizosaccharomyces pombe: a representative of a family of 10 transmembrane helix transporter proteins of yeasts. Yeast 14(11):1051-9	|DAL4 |FUI1 |NRT1 |THI7
Protein Processing/Modification/Regulation Regulation of	Galan JM and Haguenauer-Tsapis R (1997) Ubiquitin lys63 is involved in ubiquitination of a yeast plasma membrane protein. EMBO J 16(19):5847-54	|DOA4
Other Features	Hein C and Andre B (1997) A C-terminal di-leucine motif and nearby sequences are required for NH4(+)-induced inactivation and degradation of the general amino acid permease, Gap1p, of Saccharomyces cerevisiae. Mol Microbiol 24(3):607-16	|CAN1 |GAP1 |STE2
Cellular Location Protein Processing/Modification/Regulation Reviews	Hicke L (1997) Ubiquitin-dependent internalization and down-regulation of plasma membrane proteins. FASEB J 11(14):1215-26	|STE2
Cellular Location Protein Processing/Modification/Regulation	Moreau V, et al. (1997) The yeast actin-related protein Arp2p is required for the internalization step of endocytosis. Mol Biol Cell 8(7):1361-75	|ARP2 |END3
Reviews	Nelissen B, et al. (1997) Classification of all putative permeases and other membrane plurispanners of the major facilitator superfamily encoded by the complete genome of Saccharomyces cerevisiae. FEMS Microbiol Rev 21(2):113-34	|BAP3 |DIP5 |FUI1 |HIP1 |MEP1 |SEO1 |SNF3 |SSY1 |YCT1 |YIL166C
Protein Processing/Modification/Regulation Regulation of	Galan JM, et al. (1996) Ubiquitination mediated by the Npi1p/Rsp5p ubiquitin-protein ligase is required for endocytosis of the yeast uracil permease. J Biol Chem 271(18):10946-52	|ACT1 |PEP4 |PRE1 |PRE2 |RPT1 |RPT6 |RSP5
Cellular Location Protein Physical Properties Protein Processing/Modification/Regulation Techniques and Reagents	Garnier C, et al. (1996) Membrane topology of the yeast uracil permease. Mol Microbiol 21(5):1061-73
Other Features	Ryu SL, et al. (1996) Genomic reorganization between two sibling yeast species, Saccharomyces bayanus and Saccharomyces cerevisiae. Yeast 12(8):757-64	|CEN4 |RAD57 |TRP1
Protein Processing/Modification/Regulation Regulation of	Hein C, et al. (1995) NPl1, an essential yeast gene involved in induced degradation of Gap1 and Fur4 permeases, encodes the Rsp5 ubiquitin-protein ligase. Mol Microbiol 18(1):77-87	|GAP1 |RSP5
Fungal Related Genes/Proteins Other Features	Nelissen B, et al. (1995) Phylogenetic classification of the major superfamily of membrane transport facilitators, as deduced from yeast genome sequencing. FEBS Lett 377(2):232-6	|DAL4 |DUR3 |FCY2 |FEN2 |FUI1 |HOL1 |HXT11 |HXT12 |HXT17 |HXT9 |PHO84 |PTR2 |SGE1 |SNF3 |MORE
Reviews	Sophianopoulou V and Diallinas G (1995) Amino acid transporters of lower eukaryotes: regulation, structure and topogenesis. FEMS Microbiol Rev 16(1):53-75	|AUA1 |CAN1 |DAL5 |DAL80 |DAL81 |GAP1 |GCN4 |GLN3 |GNP1 |HIP1 |LYP1 |NPR1 |PUT4 |RSP5 |MORE
Cellular Location Mutants/Phenotypes Protein Physical Properties Protein Processing/Modification/Regulation Protein Sequence Features Strains/Constructs	Urban-Grimal D, et al. (1995) Replacement of Lys by Glu in a transmembrane segment strongly impairs the function of the uracil permease from Saccharomyces cerevisiae. Biochem J 308 ( Pt 3)():847-51
Fungal Related Genes/Proteins	De Wergifosse P, et al. (1994) The sequence of a 22.4 kb DNA fragment from the left arm of yeast chromosome II reveals homologues to bacterial proline synthetase and murine alpha-adaptin, as well as a new permease and a DNA-binding protein. Yeast 10(11):1489-96	|COR1 |DAL4 |EDE1 |ERD2 |FUI1 |PRE7 |UBP5 |URA7
DNA/RNA Sequence Features Mapping	Feldmann H, et al. (1994) Complete DNA sequence of yeast chromosome II. EMBO J 13(24):5795-809	|ALG3 |AST1 |CDS1 |CHS3 |CMD1 |COQ1 |COR1 |CST26 |CTP1 |DER1 |DUR1,2 |ECM1 |FIG1 |FUI1 |MORE
Mutants/Phenotypes Protein Processing/Modification/Regulation Protein Sequence Features Regulation of Strains/Constructs	Galan JM, et al. (1994) The yeast plasma membrane uracil permease is stabilized against stress induced degradation by a point mutation in a cyclin-like "destruction box". Biochem Biophys Res Commun 201(2):769-75
DNA/RNA Sequence Features Mapping	Romero PA, et al. (1994) The nucleotide sequence of TTP1, a gene encoding a predicted type II membrane protein. Yeast 10(8):1111-5	|CEN2 |MNN2
DNA/RNA Sequence Features Mapping	Smits PH, et al. (1994) The complete sequence of a 33 kb fragment on the right arm of chromosome II from Saccharomyces cerevisiae reveals 16 open reading frames, including ten new open reading frames, five previously identified genes and a homologue of the SCO1 gene. Yeast 10 Suppl A():S75-80	|CHS3 |EDS1 |GAL1 |GAL10 |OLA1 |PDX3 |POA1 |RKM3 |SCO1 |SCO2 |YBR028C |YPK2
Protein Processing/Modification/Regulation	Volland C, et al. (1994) Endocytose and degradation of the uracil permease of S. cerevisiae under stress conditions: possible role of ubiquitin. Folia Microbiol (Praha) 39(6):554-7
Protein Physical Properties Protein Processing/Modification/Regulation Regulation of	Volland C, et al. (1994) Endocytosis and degradation of the yeast uracil permease under adverse conditions. J Biol Chem 269(13):9833-41	|END3 |PEP4 |SLA2
Protein Processing/Modification/Regulation	Volland C, et al. (1992) In vivo phosphorylation of the yeast uracil permease. J Biol Chem 267(33):23767-71
Fungal Related Genes/Proteins	Yoo HS, et al. (1992) The allantoin and uracil permease gene sequences of Saccharomyces cerevisiae are nearly identical. Yeast 8(12):997-1006	|DAL4
Protein Physical Properties Protein Processing/Modification/Regulation Regulation of Strains/Constructs Techniques and Reagents	Silve S, et al. (1991) Membrane insertion of uracil permease, a polytopic yeast plasma membrane protein. Mol Cell Biol 11(2):1114-24	|SEC61 |SEC62
DNA/RNA Sequence Features Protein Sequence Features	Jund R, et al. (1988) Primary structure of the uracil transport protein of Saccharomyces cerevisiae. Eur J Biochem 171(1-2):417-24
Other Features Protein/Nucleic Acid Structure	Weber E, et al. (1988) Evolutionary relationship and secondary structure predictions in four transport proteins of Saccharomyces cerevisiae. J Mol Evol 27(4):341-50	|CAN1 |FCY2 |HIP1
Mapping	Weber E, et al. (1986) Chromosomal mapping of the uracil permease gene of Saccharomyces cerevisiae. Curr Genet 11(2):93-6
Function/Process Mutants/Phenotypes RNA Levels and Processing Regulation of Strains/Constructs Transcription	Chevallier MR (1982) Cloning and transcriptional control of a eucaryotic permease gene. Mol Cell Biol 2(8):977-84
Function/Process Genetic Interactions	Chevallier MR and Lacroute F (1982) Expression of the cloned uracil permease gene of Saccharomyces cerevisiae in a heterologous membrane. EMBO J 1(3):375-7
Function/Process	Jund R, et al. (1977) Uracil transport in Saccharomyces cerevisiae. J Membr Biol 36(2-3):233-51
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Bach ML and Lacroute F (1972) Direct selective techniques for the isolation of pyrimidine auxotrophs in yeast. Mol Gen Genet 115(2):126-30	|URA1 |URA2 |URA3 |URA4 |URA5
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Jund R and Lacroute F (1970) Genetic and physiological aspects of resistance to 5-fluoropyrimidines in Saccharomyces cerevisiae. J Bacteriol 102(3):607-15	|FUI1

Return to SGD

Send a Message to the SGD Curators