---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

ALG3/YBL082C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrII: 71124 to 69748 CDS: 71124 - 69748 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
ALG3	YBL082C	RHK1	ORF, Verified	S000000178
Description
Dolichol-P-Man dependent alpha(1-3) mannosyltransferase, involved in the synthesis of dolichol-linked oligosaccharide donor for N-linked glycosylation of proteins

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By alpha-1,3-mannosyltransferase activity Sharma CB, et al. (2001) Biosynthesis of lipid-linked oligosaccharides in yeast: the ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase. Biol Chem 382(2):321-8        IMP : Inferred from Mutant Phenotype IDA : Inferred from Direct Assay Assigned on 2002-12-20 SGD dolichyl-phosphate-mannose-glycolipid alpha-mannosyltransferase activity GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.      IEA : Inferred from Electronic Annotation with IUBMB:2.4.1.130 Assigned on 2008-04-01 UniProtKB transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0808 Assigned on 2007-05-23 UniProtKB transferase activity, transferring glycosyl groups GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0328 Assigned on 2007-05-23 UniProtKB transferase activity, transferring hexosyl groups DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR007873 Assigned on 2009-01-12 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By oligosaccharide-lipid intermediate assembly Aebi M, et al. (1996) Cloning and characterization of the ALG3 gene of Saccharomyces cerevisiae. Glycobiology 6(4):439-44      IMP : Inferred from Mutant Phenotype Assigned on 2007-04-17 SGD Sharma CB, et al. (2001) Biosynthesis of lipid-linked oligosaccharides in yeast: the ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase. Biol Chem 382(2):321-8        IDA : Inferred from Direct Assay Assigned on 2007-04-17 SGD peptidyl-amino acid modification Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT protein amino acid glycosylation Aebi M, et al. (1996) Cloning and characterization of the ALG3 gene of Saccharomyces cerevisiae. Glycobiology 6(4):439-44      IMP : Inferred from Mutant Phenotype Assigned on 2002-11-14 SGD
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum Aebi M, et al. (1996) Cloning and characterization of the ALG3 gene of Saccharomyces cerevisiae. Glycobiology 6(4):439-44      ISS : Inferred from Sequence or structural Similarity IMP : Inferred from Mutant Phenotype Assigned on 2002-11-14 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR007873 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB integral to membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR007873 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
lipid-linked oligosaccharide biosynthesis

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for ALG3/YBL082C for ALG3 During N-linked glycosylation of proteins, oligosaccharide chains are assembled on the carrier molecule dolichyl pyrophosphate in the following order: 2 molecules of N-acetylglucosamine (GlcNAc), 9 molecules of mannose, and 3 molecules of glucose. These 14-residue oligosaccharide cores are then transferred to asparagine residues on nascent polypeptide chains in the endoplasmic reticulum (ER). As proteins progress through the Golgi apparatus, the oligosaccharide cores are modified by trimming and extension to generate a diverse array of glycosylated proteins (reviewed in 1, 2). Alg3p is an alpha 1,3 mannosyltransferase that catalyzes the addition of the sixth mannose moiety to the growing lipid-linked oligosaccharide (LLO) (3, 4). This is the first sugar added to the LLO in the lumen of the endoplasmic reticulum. The seventh mannose moiety is added by Alg9p. Disruption of ALG3 causes accumulation of lipid-linked oligosaccharides with five mannose residues (5, 3, 4). The designation RHK1 indicates that mutants are resistant to the HM-1 killer toxin from the yeast Hansenula mrakii, possibly due to defective glycosylation of the toxin receptor (6). Human ALG3 (OMIM) cDNA complements deletion of ALG3 in mutant yeast (7) and has been found to be mutated in the congenital disorder of glycosylation CDG-Id (OMIM) (7). Last Updated: 2005-07-12

Basic References [TOP]

BASIC INFORMATION REFERENCES forALG3/YBL082C for ALG3 1) Herscovics A and Orlean P (1993) Glycoprotein biosynthesis in yeast. FASEB J 7(6):540-50        2) Burda P and Aebi M (1999) The dolichol pathway of N-linked glycosylation. Biochim Biophys Acta 1426(2):239-57      3) Aebi M, et al. (1996) Cloning and characterization of the ALG3 gene of Saccharomyces cerevisiae. Glycobiology 6(4):439-44      4) Sharma CB, et al. (2001) Biosynthesis of lipid-linked oligosaccharides in yeast: the ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase. Biol Chem 382(2):321-8        5) Huffaker TC and Robbins PW (1983) Yeast mutants deficient in protein glycosylation. Proc Natl Acad Sci U S A 80(24):7466-70      6) Kimura T, et al. (1997) A novel yeast gene, RHK1, is involved in the synthesis of the cell wall receptor for the HM-1 killer toxin that inhibits beta-1,3-glucan synthesis. Mol Gen Genet 254(2):139-47      7) Korner C, et al. (1999) Carbohydrate deficient glycoprotein syndrome type IV: deficiency of dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase. EMBO J 18(23):6816-22

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for ALG3/YBL082C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for ALG3/YBL082C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MEGEQSP C-term SMEKKLN Length(aa) 458 MW(Da) 52,860 pI 9.29 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.110   Codon Adaptation Index 0.107   Frequency of Optimal Codons 0.453   Hydropathicity of Protein 0.429   Aromaticity Score 0.131

10 20 30 40 50 | | | | | MEGEQSPQGEKSLQRKQFVRPPLDLWQDLKDGVRYVIFDCRANLIVMPLL ILFESMLCKIIIKKVAYTEIDYKAYMEQIEMIQLDGMLDYSQVSGGTGPL VYPAGHVLIYKMMYWLTEGMDHVERGQVFFRYLYLLTLALQMACYYLLHL PPWCVVLACLSKRLHSIYVLRLFNDCFTTLFMVVTVLGAIVASRCHQRPK LKKSLALVISATYSMAVSIKMNALLYFPAMMISLFILNDANVILTLLDLV AMIAWQVAVAVPFLRSFPQQYLHCAFNFGRKFMYQWSINWQMMDEEAFND KRFHLALLISHLIALTTLFVTRYPRILPDLWSSLCHPLRKNAVLNANPAK TIPFVLIASNFIGVLFSRSLHYQFLSWYHWTLPILIFWSGMPFFVGPIWY VLHEWCWNSYPPNSQASTLLLALNTVLLLLLALTQLSGSVALAKSHLRTT SSMEKKLN*

Protein Structures from PDB: proteins of known structure with sequence similarity to ALG3/YBL082C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
ALG3	Huffaker TC and Robbins PW (1983) Yeast mutants deficient in protein glycosylation. Proc Natl Acad Sci U S A 80(24):7466-70

Alias Name(s)	Reference
RHK1	Kimura T, et al. (1997) A novel yeast gene, RHK1, is involved in the synthesis of the cell wall receptor for the HM-1 killer toxin that inhibits beta-1,3-glucan synthesis. Mol Gen Genet 254(2):139-47

Nomenclature History Notes

Date	Note
2005-06-02	Upon consensus among the community, the standard name for YBL082C has been changed from RHK1 to ALG3, as ALG3 has been the more commonly used name for this gene.

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YBL082C	SGD Systematic Sequence
852196	NCBI: Gene ID
NP_009471.1	NCBI: RefSeq protein version ID
NP_009471.1	NCBI: RefSeq protein version ID
6319389	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
43 curated references; 0 references not yet curated
Strains/Constructs Techniques and Reagents	Clark KM, et al. (2009) Purification of Transmembrane Proteins from Saccharomyces cerevisiae for X-ray Crystallography. Protein Expr Purif	|AAC1 |AAC3 |ADP1 |ALG7 |BOR1 |CHO1 |DGA1 |DPP1 |ENA5 |EPT1 |GPT2 |LPP1 |NFT1 |PDR10 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Clerc S, et al. (2009) Htm1 protein generates the N-glycan signal for glycoprotein degradation in the endoplasmic reticulum. J Cell Biol 184(1):159-72	|ALG12 |ALG8 |ALG9 |MNL1 |MNS1 |PDI1 |PRC1 |ROT2 |YOS9
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Copic A, et al. (2009) Genomewide analysis reveals novel pathways affecting endoplasmic reticulum homeostasis, protein modification and quality control. Genetics 182(3):757-69	|CSF1 |EOS1 |HAC1 |HTZ1 |KAR2 |LHS1 |MNN11 |MRPL16 |PHO88 |UBX2 |YLR065C
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Jonikas MC, et al. (2009) Comprehensive characterization of genes required for protein folding in the endoplasmic reticulum. Science 323(5922):1693-7	|AIM27 |ALG12 |ALG5 |ALG6 |ALG8 |ALG9 |CUE1 |DER1 |DIE2 |EMC1 |EMC2 |EMC4 |EMC6 |GET1 |MORE
Fungal Related Genes/Proteins	Deshpande N, et al. (2008) Protein glycosylation pathways in filamentous fungi. Glycobiology 18(8):626-37	|ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG6 |ALG7 |ALG8 |ALG9 |ANP1 |CWH41 |DIE2 |DPM1 |MORE
Cross-species Expression Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Henquet M, et al. (2008) Identification of the Gene Encoding the {alpha}1,3-Mannosyltransferase (ALG3) in Arabidopsis and Characterization of Downstream N-Glycan Processing. Plant Cell 20(6):1652-64
Reviews	Jigami Y (2008) Yeast glycobiology and its application. Biosci Biotechnol Biochem 72(3):637-48	|ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG5 |ALG6 |ALG7 |ALG8 |ALG9 |ANP1 |CWH41 |DIE2 |MORE
Cellular Location Computational analysis	Qi Y, et al. (2008) Finding friends and enemies in an enemies-only network: A graph diffusion kernel for predicting novel genetic interactions and co-complex membership from yeast genetic interactions. Genome Res 18(12):1991-2004	|AAH1 |ADA2 |AGE1 |AGE2 |AIM29 |ALG5 |ALG6 |ALG8 |ALG9 |ANP1 |ARL3 |ARP3 |ARP4 |ASK1 |MORE
Reviews	Lehle L, et al. (2006) Protein glycosylation, conserved from yeast to man: a model organism helps elucidate congenital human diseases. Angew Chem Int Ed Engl 45(41):6802-18	|ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG5 |ALG6 |ALG7 |ALG8 |ALG9 |DIE2 |DPM1 |OST1 |MORE
Alias Cross-species Expression	Miyamoto M, et al. (2006) The role of the histidine-35 residue in the cytocidal action of HM-1 killer toxin. Microbiology 152(Pt 10):2951-8
Mutants/Phenotypes	Chen Y, et al. (2005) Identification of mitogen-activated protein kinase signaling pathways that confer resistance to endoplasmic reticulum stress in Saccharomyces cerevisiae. Mol Cancer Res 3(12):669-77	|ALG8 |ALG9 |ARD1 |BCK1 |CMR2 |CNB1 |DAL81 |DID2 |EDE1 |ERV25 |FPS1 |FYV8 |HAC1 |HOG1 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Mendelsohn RD, et al. (2005) A hypomorphic allele of the first N-glycosylation gene, ALG7, causes mitochondrial defects in yeast. Biochim Biophys Acta 1723(1-3):33-44	|ALG5 |ALG6 |ALG7 |CHS1 |CNE1 |GPX2 |GSC2 |KAR2 |URA3 |YBR241C |YBR242W
Function/Process Genetic Interactions	Schuldiner M, et al. (2005) Exploration of the function and organization of the yeast early secretory pathway through an epistatic miniarray profile. Cell 123(3):507-19	|ALG12 |ALG5 |ALG6 |ALG8 |ALG9 |API2 |APL5 |APL6 |APM3 |APS3 |ARL1 |ARL3 |ARV1 |BIG1 |MORE
Mutants/Phenotypes Strains/Constructs	Stephens C, et al. (2005) The mode of action of the plant antimicrobial peptide MiAMP1 differs from that of its structural homologue, the yeast killer toxin WmKT. FEMS Microbiol Lett 243(1):205-10	|IPT1 |STT3
Function/Process Mutants/Phenotypes	Szathmary R, et al. (2005) Yos9 protein is essential for degradation of misfolded glycoproteins and may function as lectin in ERAD. Mol Cell 19(6):765-75	|ALG12 |ALG9 |MNL1 |MNS1 |PRC1 |YOS9
Fungal Related Genes/Proteins	Davidson RC, et al. (2004) Functional analysis of the ALG3 gene encoding the Dol-P-Man: Man5GlcNAc2-PP-Dol mannosyltransferase enzyme of P. pastoris. Glycobiology 14(5):399-407	|OCH1
Genetic Interactions Strains/Constructs	Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13	|AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Deutschbauer AM, et al. (2002) Parallel phenotypic analysis of sporulation and postgermination growth in Saccharomyces cerevisiae. Proc Natl Acad Sci U S A 99(24):15530-5	|ECM18 |EMI5 |IRC19 |MRPS16 |MUM3 |PMA2 |SMA2 |SOP4 |YAP3 |YBL083C |YBR027C |YJR120W
Alias Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Cipollo JF, et al. (2001) The yeast ALG11 gene specifies addition of the terminal alpha 1,2-Man to the Man5GlcNAc2-PP-dolichol N-glycosylation intermediate formed on the cytosolic side of the endoplasmic reticulum. J Biol Chem 276(24):21828-40	|ALG11 |ALG2 |OCH1
Alias Function/Process Techniques and Reagents	Kelleher DJ, et al. (2001) Large-scale isolation of dolichol-linked oligosaccharides with homogeneous oligosaccharide structures: determination of steady-state dolichol-linked oligosaccharide compositions. Glycobiology 11(4):321-33
Cellular Location Function/Process Strains/Constructs Substrates/Ligands/Cofactors	Sharma CB, et al. (2001) Biosynthesis of lipid-linked oligosaccharides in yeast: the ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase. Biol Chem 382(2):321-8
Alias Function/Process Mutants/Phenotypes Regulatory Role Strains/Constructs	Cipollo JF and Trimble RB (2000) The accumulation of Man(6)GlcNAc(2)-PP-dolichol in the Saccharomyces cerevisiae Deltaalg9 mutant reveals a regulatory role for the Alg3p alpha1,3-Man middle-arm addition in downstream oligosaccharide-lipid and glycoprotein glycan processing. J Biol Chem 275(6):4267-77	|ALG6 |ALG8 |ALG9 |CWH41 |DIE2 |OCH1 |ROT2 |SEC18
Mutants/Phenotypes Other Features Strains/Constructs	Shirai T, et al. (2000) The involvement of two specific arginine residues in the action of HM-1 killer toxin was deduced from site-directed mutagenesis. Biol Pharm Bull 23(8):998-1000
Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Strains/Constructs	Kimura T, et al. (1999) N-glycosylation is involved in the sensitivity of Saccharomyces cerevisiae to HM-1 killer toxin secreted from Hansenula mrakii IFO 0895. Appl Microbiol Biotechnol 51(2):176-84	|STT3
Disease Gene Related Function/Process Non-Fungal Related Genes/Proteins	Korner C, et al. (1999) Carbohydrate deficient glycoprotein syndrome type IV: deficiency of dolichyl-P-Man:Man(5)GlcNAc(2)-PP-dolichyl mannosyltransferase. EMBO J 18(23):6816-22
Reviews	Kukuruzinska MA and Lennon-Hopkins K (1999) ALG gene expression and cell cycle progression. Biochim Biophys Acta 1426(2):359-72	|ALG2 |ALG7
DNA/RNA Sequence Features Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Kimura T, et al. (1997) A novel yeast gene, RHK1, is involved in the synthesis of the cell wall receptor for the HM-1 killer toxin that inhibits beta-1,3-glucan synthesis. Mol Gen Genet 254(2):139-47
Alias DNA/RNA Sequence Features Protein Sequence Features Strains/Constructs	Aebi M, et al. (1996) Cloning and characterization of the ALG3 gene of Saccharomyces cerevisiae. Glycobiology 6(4):439-44	|STT3
Alias Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Burda P, et al. (1996) Stepwise assembly of the lipid-linked oligosaccharide in the endoplasmic reticulum of Saccharomyces cerevisiae: identification of the ALG9 gene encoding a putative mannosyl transferase. Proc Natl Acad Sci U S A 93(14):7160-5	|ALG9 |WBP1
Alias Mutants/Phenotypes	Cueva R, et al. (1996) Preferential transfer to truncated oligosaccharides to the first sequon of yeast exoglucanase in Saccharomyces cerevisiae alg3 cells. Biochim Biophys Acta 1289(3):336-42	|GLC3
Mutants/Phenotypes	Dean N (1995) Yeast glycosylation mutants are sensitive to aminoglycosides. Proc Natl Acad Sci U S A 92(5):1287-91	|ALG1 |ALG2 |ALG5 |ANP1 |CWH41 |MNN1 |MNN10 |MNN2 |MNN9 |SEC53 |VRG4 |WBP1
DNA/RNA Sequence Features Mapping	Obermaier B, et al. (1995) Sequence analysis of a 78.6 kb segment of the left end of Saccharomyces cerevisiae chromosome II. Yeast 11(11):1103-12	|ATP1 |BOI1 |CDC27 |ILS1 |MRP21 |PET112 |PKC1 |ROX3 |RPL23A |RPL32 |SRO77 |TEL1 |YBL081W |YBL086C |MORE
Alias Mutants/Phenotypes	Verostek MF and Trimble RB (1995) Mannosyltransferase activities in membranes from various yeast strains. Glycobiology 5(7):671-81	|KRE2 |MNN1 |OCH1 |PMR1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Zufferey R, et al. (1995) STT3, a highly conserved protein required for yeast oligosaccharyl transferase activity in vivo. EMBO J 14(20):4949-60	|ALG5 |ALG6 |ALG8 |ALG9 |DIE2 |STT3 |WBP1
DNA/RNA Sequence Features Mapping	Cusick ME (1994) Sequence of a segment of yeast chromosome II shows two novel genes, one almost entirely hydrophobic and the other extremely asparagine-serine rich. Yeast 10(9):1251-6	|CDC27 |ILS1 |YBL081W
DNA/RNA Sequence Features Mapping	Feldmann H, et al. (1994) Complete DNA sequence of yeast chromosome II. EMBO J 13(24):5795-809	|AST1 |CDS1 |CHS3 |CMD1 |COQ1 |COR1 |CST26 |CTP1 |DER1 |DUR1,2 |ECM1 |FIG1 |FUI1 |FUR4 |MORE
Reviews	Herscovics A and Orlean P (1993) Glycoprotein biosynthesis in yeast. FASEB J 7(6):540-50	|ALG1 |ALG2 |ALG5 |ALG6 |ALG7 |ALG8 |ANP1 |CWH41 |DPM1 |GDA1 |GFA1 |KRE2 |MNN1 |MNN10 |MORE
Alias Genetic Interactions	Nakanishi-Shindo Y, et al. (1993) Structure of the N-linked oligosaccharides that show the complete loss of alpha-1,6-polymannose outer chain from och1, och1 mnn1, and och1 mnn1 alg3 mutants of Saccharomyces cerevisiae. J Biol Chem 268(35):26338-45	|MNN1 |OCH1
Alias Genetic Interactions Mutants/Phenotypes	Verostek MF, et al. (1993) Glycoprotein biosynthesis in the alg3 Saccharomyces cerevisiae mutant. I. Role of glucose in the initial glycosylation of invertase in the endoplasmic reticulum. J Biol Chem 268(16):12095-103	|CWH41 |GLC3 |SUC2
Alias Mutants/Phenotypes	Verostek MF, et al. (1993) Glycoprotein biosynthesis in the alg3 Saccharomyces cerevisiae mutant. II. Structure of novel Man6-10GlcNAc2 processing intermediates on secreted invertase. J Biol Chem 268(16):12104-15	|MNN1 |MNN10
Reviews	Conzelmann A, et al. (1991) Biosynthesis of glycophosphoinositol anchors in Saccharomyces cerevisiae. Cell Biol Int Rep 15(9):863-73	|ALG2 |DPM1 |GAS1 |KRE1 |MNN9 |SEC53
Alias Mutants/Phenotypes	Verostek MF, et al. (1991) Structure of Saccharomyces cerevisiae alg3, sec18 mutant oligosaccharides. J Biol Chem 266(9):5547-51	|SEC18
Alias Fungal Related Genes/Proteins Mutants/Phenotypes Strains/Constructs	Huffaker TC and Robbins PW (1983) Yeast mutants deficient in protein glycosylation. Proc Natl Acad Sci U S A 80(24):7466-70	|ALG1 |ALG2 |ALG5 |ALG6 |SEC53

Return to SGD

Send a Message to the SGD Curators