---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

NUP170/YBL079W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrII: 75256 to 79764 CDS: 75256 - 79764 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
NUP170	YBL079W	NLE3	ORF, Verified	S000000175
Description
Subunit of the nuclear pore complex (NPC), required for NPC localization of specific nucleoporins; involved in nuclear envelope permeability and chromosome segregation; has similar to Nup157p; essential role, with Nup157p, in NPC assembly

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By structural constituent of nuclear pore DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR004870 Assigned on 2007-05-23 UniProtKB structural molecule activity Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By NLS-bearing substrate import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD chromosome segregation Kerscher O, et al. (2001) Novel role for a Saccharomyces cerevisiae nucleoporin, Nup170p, in chromosome segregation. Genetics 157(4):1543-53        IMP : Inferred from Mutant Phenotype Assigned on 2003-07-21 SGD establishment of protein localization Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT mRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD mRNA transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0509 Assigned on 2007-05-23 UniProtKB mRNA-binding (hnRNP) protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD nuclear pore complex assembly Makio T, et al. (2009) The nucleoporins Nup170p and Nup157p are essential for nuclear pore complex assembly. J Cell Biol 185(3):459-73        IGI : Inferred from Genetic Interaction with SGD:NUP157 Assigned on 2009-05-11 SGD nuclear pore organization Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD nucleocytoplasmic transport DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR004870 Assigned on 2007-05-23 UniProtKB protein export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD protein import into nucleus, docking Marelli M, et al. (1998) Specific binding of the karyopherin Kap121p to a subunit of the nuclear pore complex containing Nup53p, Nup59p, and Nup170p. J Cell Biol 143(7):1813-30        IPI : Inferred from Physical Interaction Assigned on 2001-01-18 SGD protein targeting to membrane King MC, et al. (2006) Karyopherin-mediated import of integral inner nuclear membrane proteins. Nature 442(7106):1003-7      IMP : Inferred from Mutant Phenotype Assigned on 2007-10-02 SGD protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0653 Assigned on 2007-05-23 UniProtKB rRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD ribosomal protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD snRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD snRNP protein import into nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD tRNA export from nucleus Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD transmembrane transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0811 Assigned on 2009-10-01 UniProtKB transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB karyopherin docking complex Marelli M, et al. (1998) Specific binding of the karyopherin Kap121p to a subunit of the nuclear pore complex containing Nup53p, Nup59p, and Nup170p. J Cell Biol 143(7):1813-30        IDA : Inferred from Direct Assay Assigned on 2009-10-09 SGD membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB nuclear pore Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      IDA : Inferred from Direct Assay Assigned on 2001-01-18 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR004870 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0906 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0185 Assigned on 2009-05-06 UniProtKB nucleus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0539 Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for NUP170/YBL079W for NUP170 NUP170 encodes a nuclear pore protein (1, 2). Transport of macromolecules between the nucleus and the cytoplasm of eukaryotic cells occurs through the nuclear pore complex (NPC), a large macromolecular complex that spans the nuclear envelope (reviewed in 2, 3, 4, 5). The structure of the vertebrate NPC has been studied extensively; recent reviews include 6, 7, 8, and 9. The yeast NPC shares several features with the vertebrate NPC, despite being smaller and less elaborate (10, 11). Many yeast nuclear pore proteins, or nucleoporins, have been identified by a variety of genetic approaches (reviewed in 2, 3, 12, 13, 14). Nup170p is one of the most abundant yeast nucleoporins (1). Nup170p interacts physically with other abundant yeast nucleoporins, Nic96p, Pom152p, Nup157p, and Nup188p (15, 2). These abundant nucleoporins may form the structural core of the NPC (2). Also, Nup170p forms a complex with the nucleoporins Nup53p and Asm4p (16). The complex is found on both the nuclear and cytoplasmic faces of the NPC, and associates with Pse1p, a member of a protein family implicated in nuclear protein import. Nup157p and Nup170p are very similar to each other and to a mammalian nucleoporin, Nup155 (1, 17, 2). NUP170 is not essential, but nup170 mutations are synthetically lethal with mutations in several other nucleoporin genes (18, 2). Last Updated: 1999-08-12

Basic References [TOP]

BASIC INFORMATION REFERENCES forNUP170/YBL079W for NUP170 1) Aitchison JD, et al. (1995) Two novel related yeast nucleoporins Nup170p and Nup157p: complementation with the vertebrate homologue Nup155p and functional interactions with the yeast nuclear pore-membrane protein Pom152p. J Cell Biol 131(5):1133-48      2) Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313      3) Wente SR, et al. (1997) "The nucleus and nucleocytoplasmic transport in Saccharomyces cerevisiae." Pp. 471-546 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press    4) Pemberton LF, et al. (1998) Transport routes through the nuclear pore complex. Curr Opin Cell Biol 10(3):392-9      5) Izaurralde E and Adam S (1998) Transport of macromolecules between the nucleus and the cytoplasm. RNA 4(4):351-64      6) Hinshaw JE (1994) Architecture of the nuclear pore complex and its involvement in nucleocytoplasmic transport. Biochem Pharmacol 47(1):15-20      7) Pante N and Aebi U (1996) Molecular dissection of the nuclear pore complex. Crit Rev Biochem Mol Biol 31(2):153-99      8) Davis LI (1995) The nuclear pore complex. Annu Rev Biochem 64:865-96      9) Pante N and Aebi U (1994) Toward the molecular details of the nuclear pore complex. J Struct Biol 113(3):179-89      10) Rout MP and Blobel G (1993) Isolation of the yeast nuclear pore complex. J Cell Biol 123(4):771-83      11) Yang Q, et al. (1998) Three-dimensional architecture of the isolated yeast nuclear pore complex: functional and evolutionary implications. Mol Cell 1(2):223-34        12) Doye V and Hurt E (1997) From nucleoporins to nuclear pore complexes. Curr Opin Cell Biol 9(3):401-11      13) Doye V and Hurt EC (1995) Genetic approaches to nuclear pore structure and function. Trends Genet 11(6):235-41        14) Newmeyer DD (1993) The nuclear pore complex and nucleocytoplasmic transport. Curr Opin Cell Biol 5(3):395-407      15) Nehrbass U, et al. (1996) The yeast nucleoporin Nup188p interacts genetically and physically with the core structures of the nuclear pore complex. J Cell Biol 133(6):1153-62      16) Marelli M, et al. (1998) Specific binding of the karyopherin Kap121p to a subunit of the nuclear pore complex containing Nup53p, Nup59p, and Nup170p. J Cell Biol 143(7):1813-30        17) Kenna MA, et al. (1996) Yeast N1e3p/Nup170p is required for normal stoichiometry of FG nucleoporins within the nuclear pore complex. Mol Cell Biol 16(5):2025-36        18) Tcheperegine SE, et al. (1999) Topology and functional domains of the yeast pore membrane protein Pom152p. J Biol Chem 274(8):5252-8        19) Shulga N, et al. (2000) Yeast nucleoporins involved in passive nuclear envelope permeability. J Cell Biol 149(5):1027-38        20) Rout MP, et al. (2000) The yeast nuclear pore complex: composition, architecture, and transport mechanism. J Cell Biol 148(4):635-51        21) Kerscher O, et al. (2001) Novel role for a Saccharomyces cerevisiae nucleoporin, Nup170p, in chromosome segregation. Genetics 157(4):1543-53        22) Makio T, et al. (2009) The nucleoporins Nup170p and Nup157p are essential for nuclear pore complex assembly. J Cell Biol 185(3):459-73

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for NUP170/YBL079W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for NUP170/YBL079W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MFQSFFH C-term GICFYKE Length(aa) 1,502 MW(Da) 169,473 pI 6.04 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.078   Codon Adaptation Index 0.151   Frequency of Optimal Codons 0.463   Hydropathicity of Protein -0.189   Aromaticity Score 0.100

10 20 30 40 50 | | | | | MFQSFFHNNGPAAAGETFSDSRSYPLTNHQEVPRNGLNELASSATKAQQQ PTHILNSYPITGSNPLMRASAMGATSGSINPNMSNMNEHIRVSGMGTSKP LDLAGKYIDHLQHKDSNTPVLDERSYYNSGVDYNFSREKNGLGAFTPFEK QDVFNIPDEILHEFSTSQTKTDMGIFPELNRCWITIDNKLILWNINNDNE YQVVDDMKHTIQKVALVRPKPNTFVPAVKHLLLISTTMELFMFAISLDKA TNELSVFNTHLSVPVQGIDVIDIVSHERSGRIFFAGQASGLNIWELHYSG SDDWFNSKCSKVCLTKSALLSLLPTNMLSQIPGVDFIQALFEDNSNGNGG FSQETITQLTIDQQRGIIYSLSSKSTIRAYVITEKSLEGPMSIEPAYISR IIGTTTARAAPILGPKYLKIVKISSVAPEENNNLFLVALTVGGVRLYFNG SMGRFNIEALRLESIKFPPSSVTPEVIQQELLHQQQEQAKRSFPFFSNLM SSEPVLLKFQKKSSVLLETTKASTIISPGIFFSAVIKSSQQTHQQEKKEN SSVTGTTATAGSKTVKQQPVTLQHKLFVSVPDYGILKTHGKYVENATFLE TAGPVQQIIPLSGLFNATTKPQGFANEFATQYTSETLRVAVLTSTSIEIY KYRTPDEIFEDLIDNPLPFVLNYGAAEACSTALFVTCKSNKSEKLRSNAL TFLTMGIPGVVDIKPVYNRYSVSTVSSLLSKPTLSTATTNLQQSITGFSK PSPANKEDFDLDDVILSPRFYGIALLITRLLRDIWGRHVFMTFTDNRVTS HAFISSSDPITPSINNLKSDEISQNRNIISKVSISKDCIEYYLSSINILN EFFITYGDSISQISAPYVLANNSNGRVIDKTEEVANQAESIAINAMIKMV QSIKEGLSFLNVLYEESEVEGFDNQYLGFKDIISFVSLDVQKDLVKLDFK DLFAPNDKTKSLIREILLSIINRNITKGASIEYTATALQERCGSFCSASD ILGFRAIEHLRRAKEIGLRNYDSLNYHLKNATALLEQIVDDLSIEKLKEA VSMMLSVNYYPKSIEFLLNIANSMDKGKLACQYVANGFLENDDRKQYYDK RILVYDLVFDTLIKVDELAEKKQSSKTQNQISISNDDEVKLRQKSYEAAL KYNDRLFHYHMYDWLVSQNREEKLLDIETPFILPYLMEKAGSSLKISNIL WVYYSRRSKFFESAEILYRLATSNFDITLFERIEFLSRANGFCNSVSPLS QKQRIVQLASRIQDACEVAGIQGDILSLVYTDARIDSAIKDELIKTLDGK ILSTSELFNDFAVPLSYHEIALFIFKIADFRDHEVIMAKWDELFQSLRME FNNTGKKEDSMNFINLLSNVLIKIGKNVQDSEFIFPIFELFPIVCNFFYE TLPKEHIVSGSIVSIFITAGVSFNKMYYILKELIETSDSDNSVFNKEMTW LIHEWYKSDRKFRDIISYNDIIHLKEYKIDNDPIEKYVKNSGNNLGICFY KE*

Protein Structures from PDB: proteins of known structure with sequence similarity to NUP170/YBL079W, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to NUP170 Homolog Source (per PDB) Protein Alignment: NUP170 vs. Homolog External Links P-Value %Identical %Similar Alignment 3i5p ( Chain: A) Nucleoporin NUP170 PDB_Info PDB_Structure Unknown 9.9e-262 100 0 View alignment SCOP MMDB CATH 3i5q ( Chain: A, B) Nucleoporin NUP170 PDB_Info PDB_Structure Unknown Chain A = 7.1e-105 100 0 View alignment SCOP MMDB CATH Chain B = 7.1e-105 100 0 View alignment

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
NUP170	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YBL079W	SGD Systematic Sequence
852199	NCBI: Gene ID
NP_009474.1	NCBI: RefSeq protein version ID
NP_009474.1	NCBI: RefSeq protein version ID
6319392	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) Organelle DB (UMich) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]

Alleles, Strains, & Mutant Phenotypes Topic Research Highlight Reference Contributor Complete Deletion Description: Null mutants display defects in chromosome transmission fidelity and kinetochore integrity Phenotype description: LossFunction Kerscher O, et al. (2001) Novel role for a Saccharomyces cerevisiae nucleoporin, Nup170p, in chromosome segregation. Genetics 157(4):1543-53        Munira Basrai 2005-07-29

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
54 curated references; 0 references not yet curated
Protein-protein Interactions	Luo Y, et al. (2010) Resolving the Composition of Protein Complexes Using a MALDI LTQ Orbitrap. J Am Soc Mass Spectrom 21(1):34-46	|APL1 |APL3 |APM4 |APS2 |ASM4 |BMH2 |EDE1 |FKS1 |NIC96 |NSP1 |NUP120 |NUP133 |NUP145 |NUP159 |MORE
Evolution Non-Fungal Related Genes/Proteins	DeGrasse JA, et al. (2009) Evidence for a shared nuclear pore complex architecture that is conserved from the last common eukaryotic ancestor. Mol Cell Proteomics 8(9):2119-30	|MLP1 |MLP2 |NIC96 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP188 |NUP192 |NUP2 |NUP82 |NUP84 |NUP85
Genetic Interactions Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Protein/Nucleic Acid Structure Strains/Constructs	Flemming D, et al. (2009) Two structurally distinct domains of the nucleoporin Nup170 cooperate to tether a subset of nucleoporins to nuclear pores. J Cell Biol 185(3):387-95	|NUP1 |NUP157 |NUP159 |NUP188 |NUP2 |NUP82 |POM152 |POM34
Mutants/Phenotypes Strains/Constructs	Kim TY, et al. (2009) Differential subcellular localization of ribosomal protein L7 paralogs in Saccharomyces cerevisiae. Mol Cells 27(5):539-46	|CGR1 |LOC1 |LOS1 |NSR1 |NUP2 |RPL7A |RPL7B |SLX9
Other Features Protein/Nucleic Acid Structure	Lezon TR, et al. (2009) Global motions of the nuclear pore complex: insights from elastic network models. PLoS Comput Biol 5(9):e1000496	|NUP120 |NUP145 |NUP157 |NUP192 |NUP84 |NUP85 |SEC13 |SEH1
Function/Process Genetic Interactions Mutants/Phenotypes Regulatory Role Strains/Constructs	Makio T, et al. (2009) The nucleoporins Nup170p and Nup157p are essential for nuclear pore complex assembly. J Cell Biol 185(3):459-73	|APQ12 |ASM4 |GLE1 |KAP104 |KAP123 |KAP95 |MLP1 |NAB2 |NDC1 |NUP1 |NUP100 |NUP133 |NUP157 |NUP159 |MORE
Protein-protein Interactions	Onischenko E, et al. (2009) Role of the Ndc1 interaction network in yeast nuclear pore complex assembly and maintenance. J Cell Biol 185(3):475-91	|ASM4 |MPS3 |NDC1 |NPL3 |NUP133 |NUP157 |NUP188 |NUP2 |NUP53 |NUP82 |POM152 |POM34
Reviews	Rexach M (2009) Piecing together nuclear pore complex assembly during interphase. J Cell Biol 185(3):377-9	|ASM4 |NDC1 |NIC96 |NUP157 |NUP188 |NUP53 |NUP82 |NUP84 |POM152 |POM34 |RTN1 |YOP1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Amaro IA, et al. (2008) The Saccharomyces cerevisiae Homolog of p24 Is Essential for Maintaining the Association of p150Glued With the Dynactin Complex. Genetics 178(2):703-9	|AIM4 |APQ12 |ARP1 |ARP10 |ASE1 |BIK1 |BIM1 |BNI1 |BUB1 |BUB3 |CHL4 |CIN1 |CIN2 |CTF18 |MORE
Genetic Interactions	Bennett CB, et al. (2008) Yeast Screens Identify the RNA Polymerase II CTD and SPT5 as Relevant Targets of BRCA1 Interaction. PLoS ONE 3(1):e1448	|APT1 |ASM4 |ATE1 |BBC1 |BEM4 |BUR2 |CCR4 |CTK1 |DAN1 |DEF1 |DHH1 |GYP5 |HDA3 |MET18 |MORE
Strains/Constructs	Harper NC, et al. (2008) Mutations affecting spindle pole body and mitotic exit network function are synthetically lethal with a deletion of the nucleoporin NUP1 in S. cerevisiae. Curr Genet 53(2):95-105	|BFA1 |BUB2 |DBF2 |LTE1 |NIC96 |NSP1 |NUD1 |NUP1 |NUP60 |SWI5
Mutants/Phenotypes Strains/Constructs	Ruotolo R, et al. (2008) Membrane transporters and protein traffic networks differentially affecting metal tolerance: a genomic phenotyping study in yeast. Genome Biol 9(4):R67	|AAT2 |AFT1 |ALF1 |APL5 |APL6 |APM3 |APS3 |ARO2 |BCK1 |BUB3 |CCC2 |CCR4 |CDC10 |CLC1 |MORE
Cellular Location Computational analysis Protein Physical Properties Protein-protein Interactions Protein/Nucleic Acid Structure	Alber F, et al. (2007) Determining the architectures of macromolecular assemblies. Nature 450(7170):683-94	|ASM4 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |MORE
Cellular Location Evolution Protein/Nucleic Acid Structure	Alber F, et al. (2007) The molecular architecture of the nuclear pore complex. Nature 450(7170):695-701	|ASM4 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |MORE
Genetic Interactions Strains/Constructs	Lusk CP, et al. (2007) Nup53p is a Target of Two Mitotic Kinases, Cdk1p and Hrr25p. Traffic 8(6):647-60	|CDC28 |HRR25 |MAD1 |NUP53 |PSE1
Protein-protein Interactions Techniques and Reagents	Oeffinger M, et al. (2007) Comprehensive analysis of diverse ribonucleoprotein complexes. Nat Methods 4(11):951-6	|ACB1 |ACT1 |ADE3 |AIM34 |ASH1 |ASM4 |BEM2 |BRR2 |BRX1 |BUD8 |CBC2 |CBF5 |CDC3 |CDC31 |MORE
Cellular Location Function/Process Protein Sequence Features Protein-protein Interactions	Patel SS, et al. (2007) Natively unfolded nucleoporins gate protein diffusion across the nuclear pore complex. Cell 129(1):83-96	|GLE1 |GLE2 |KAP95 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP157 |NUP159 |NUP192 |NUP2 |MORE
Genetic Interactions Strains/Constructs	Ryan KJ, et al. (2007) The karyopherin Kap95 regulates nuclear pore complex assembly into intact nuclear envelopes in vivo. Mol Biol Cell 18(3):886-98	|KAP95 |NIC96
Protein-protein Interactions	Strub BR, et al. (2007) Utp8p Is a Nucleolar tRNA-binding Protein That Forms a Complex with Components of the Nuclear tRNA Export Machinery in Saccharomyces cerevisiae. Mol Biol Cell 18(10):3845-59	|CCA1 |CRM1 |GRS1 |GSP1 |LOS1 |MSN5 |NAN1 |NOC4 |NOP14 |NOP58 |NUP116 |POM152 |RRS1 |TYS1 |MORE
Reviews	Taddei A (2007) Active genes at the nuclear pore complex. Curr Opin Cell Biol 19(3):305-310	|ASM4 |CDC31 |DBP5 |GAL1 |GFD1 |GLE1 |GLE2 |HSP104 |HTZ1 |INO1 |KAP120 |KAP122 |KAP123 |KAP95 |MORE
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Computational analysis Non-Fungal Related Genes/Proteins Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs	Devos D, et al. (2006) Simple fold composition and modular architecture of the nuclear pore complex. Proc Natl Acad Sci U S A 103(7):2172-7	|ASM4 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP188 |NUP192 |MORE
Mutants/Phenotypes Regulatory Role Strains/Constructs	King MC, et al. (2006) Karyopherin-mediated import of integral inner nuclear membrane proteins. Nature 442(7106):1003-7	|HEH2 |KAP114 |KAP120 |KAP122 |KAP95 |NUP2 |PSE1 |SRC1 |SRP1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Miao M, et al. (2006) The integral membrane protein pom34p functionally links nucleoporin subcomplexes. Genetics 172(3):1441-57	|ASM4 |GLE2 |NSP1 |NUP100 |NUP116 |NUP120 |NUP159 |NUP188 |NUP2 |NUP49 |NUP57 |NUP82 |POM152 |POM34 |MORE
Reviews	Santangelo GM (2006) Glucose signaling in Saccharomyces cerevisiae. Microbiol Mol Biol Rev 70(1):253-82	|ASM4 |BCY1 |CDC25 |CDC53 |CTI6 |CYC3 |CYR1 |ESC1 |GAL1 |GAL10 |GAL4 |GAL7 |GAL83 |GCR1 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Therizols P, et al. (2006) Telomere tethering at the nuclear periphery is essential for efficient DNA double strand break repair in subtelomeric region. J Cell Biol 172(2):189-99	|ESC1 |NUP120 |NUP133 |NUP145 |NUP53 |NUP84 |SIR4 |TEL11L |YKU70
Protein Physical Properties Protein-protein Interactions	Lutzmann M, et al. (2005) Reconstitution of Nup157 and Nup145N into the Nup84 complex. J Biol Chem 280(18):18442-51	|GLE2 |KAP123 |MEX67 |MLP1 |NIC96 |NSP1 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP49 |NUP57 |MORE
Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Scott RJ, et al. (2005) Interactions between Mad1p and the nuclear transport machinery in the yeast Saccharomyces cerevisiae. Mol Biol Cell 16(9):4362-74	|KAP95 |MAD1 |MLP1 |MLP2 |NUP2 |NUP53 |NUP60 |POM34 |PSE1
Protein Physical Properties Protein Sequence Features	Denning DP, et al. (2003) Disorder in the nuclear pore complex: the FG repeat regions of nucleoporins are natively unfolded. Proc Natl Acad Sci U S A 100(5):2450-5	|ASM4 |CDC31 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |MORE
Function/Process Mutants/Phenotypes	Enyenihi AH and Saunders WS (2003) Large-scale functional genomic analysis of sporulation and meiosis in Saccharomyces cerevisiae. Genetics 163(1):47-54	|ADA2 |ADY2 |AKR1 |APS3 |APT1 |ARC1 |ARG82 |ARO2 |ATF1 |ATG11 |ATG15 |ATG16 |ATG5 |BPH1 |MORE
Mutants/Phenotypes Strains/Constructs	Kushner DB, et al. (2003) Systematic, genome-wide identification of host genes affecting replication of a positive-strand RNA virus. Proc Natl Acad Sci U S A 100(26):15764-9	|ACB1 |ALF1 |AML1 |BRO1 |BUB1 |BUD26 |BUD31 |CBC2 |CDC50 |DBR1 |DED1 |DHH1 |DOA1 |DOA4 |MORE
Cellular Location Function/Process Mutants/Phenotypes Strains/Constructs	Shulga N and Goldfarb DS (2003) Binding dynamics of structural nucleoporins govern nuclear pore complex permeability and may mediate channel gating. Mol Cell Biol 23(2):534-42
Function/Process Mutants/Phenotypes	Dimmer KS, et al. (2002) Genetic basis of mitochondrial function and morphology in Saccharomyces cerevisiae. Mol Biol Cell 13(3):847-53	|ABF2 |ACO1 |ADA2 |ADK1 |AEP1 |AEP2 |AEP3 |AFG3 |AFT1 |AIM10 |AIM22 |ALY1 |APQ13 |ARG82 |MORE
Cellular Location Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Iouk T, et al. (2002) The yeast nuclear pore complex functionally interacts with components of the spindle assembly checkpoint. J Cell Biol 159(5):807-19	|ASM4 |MAD1 |MAD2 |NUP100 |NUP157 |NUP188 |NUP53 |POM152
Function/Process Protein-protein Interactions	Lusk CP, et al. (2002) Karyopherins in nuclear pore biogenesis: a role for Kap121p in the assembly of Nup53p into nuclear pore complexes. J Cell Biol 159(2):267-78	|KAP95 |NUP53 |PSE1 |SRP1
Cellular Location Protein Processing/Modification/Regulation Strains/Constructs	Ryan KJ and Wente SR (2002) Isolation and characterization of new Saccharomyces cerevisiae mutants perturbed in nuclear pore complex assembly. BMC Genet 3():17	|BET3 |NIC96 |SEC13 |SEC23 |SEC27
Cellular Location Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Protein-Nucleic Acid Interactions Strains/Constructs	Kerscher O, et al. (2001) Novel role for a Saccharomyces cerevisiae nucleoporin, Nup170p, in chromosome segregation. Genetics 157(4):1543-53	|CBF2 |CTF13 |NUP157
Cellular Location Genetic Interactions Protein-protein Interactions Regulatory Role	Marelli M, et al. (2001) A link between the synthesis of nucleoporins and the biogenesis of the nuclear envelope. J Cell Biol 153(4):709-24	|ASM4 |NDC1 |NUP53 |POM152 |PSE1
Reviews	Vasu SK and Forbes DJ (2001) Nuclear pores and nuclear assembly. Curr Opin Cell Biol 13(3):363-75	|ASM4 |CDC31 |GLE1 |GLE2 |MLP1 |MLP2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |MORE
Cellular Location Protein Physical Properties Strains/Constructs Techniques and Reagents	Rout MP, et al. (2000) The yeast nuclear pore complex: composition, architecture, and transport mechanism. J Cell Biol 148(4):635-51	|AIM4 |ASM4 |BMS1 |BUD20 |CTR9 |GLE1 |GLE2 |HAS1 |KAP120 |KAP122 |KAP123 |KAP95 |KRR1 |MEX67 |MORE
Reviews	Ryan KJ and Wente SR (2000) The nuclear pore complex: a protein machine bridging the nucleus and cytoplasm. Curr Opin Cell Biol 12(3):361-71	|CRM1 |GLE1 |KAP104 |KAP123 |KAP95 |LOS1 |MSN5 |MTR10 |NIC96 |NMD5 |NSP1 |NUP116 |NUP159 |NUP82 |MORE
Function/Process Mutants/Phenotypes Strains/Constructs	Shulga N, et al. (2000) Yeast nucleoporins involved in passive nuclear envelope permeability. J Cell Biol 149(5):1027-38	|KAP104 |KAP95 |NAB2 |NUP188 |PHO4 |PSE1 |SRP1 |SSA1
Cell Cycle Phase Involved Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Yuste-Rojas M and Cross FR (2000) Mutations in CDC14 result in high sensitivity to cyclin gene dosage in Saccharomyces cerevisiae. Mol Gen Genet 263(1):60-72	|CDC14 |CDC28 |CDC6 |CDH1 |CLB2 |CLN2 |MEC1 |SIC1
Genetic Interactions Mutants/Phenotypes	Tcheperegine SE, et al. (1999) Topology and functional domains of the yeast pore membrane protein Pom152p. J Biol Chem 274(8):5252-8	|ASM4 |NIC96 |NUP188 |POM152
Non-Fungal Related Genes/Proteins	Gigliotti S, et al. (1998) Nup154, a new Drosophila gene essential for male and female gametogenesis is related to the nup155 vertebrate nucleoporin gene. J Cell Biol 142(5):1195-207	|NUP157
Cellular Location Function/Process Protein-protein Interactions	Marelli M, et al. (1998) Specific binding of the karyopherin Kap121p to a subunit of the nuclear pore complex containing Nup53p, Nup59p, and Nup170p. J Cell Biol 143(7):1813-30	|ASM4 |NMD5 |NUP53 |POM152 |PSE1
Non-Fungal Related Genes/Proteins Techniques and Reagents	Yang Q, et al. (1998) Three-dimensional architecture of the isolated yeast nuclear pore complex: functional and evolutionary implications. Mol Cell 1(2):223-34	|GLE1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP188 |NUP2 |NUP42 |MORE
Reviews	Fabre E and Hurt E (1997) Yeast genetics to dissect the nuclear pore complex and nucleocytoplasmic trafficking. Annu Rev Genet 31:277-313	|ACC1 |ASM4 |CBC2 |GLE1 |GLE2 |GSP1 |HRP1 |KAP104 |KAP123 |KAP95 |LOS1 |MEX67 |MTR2 |MTR3 |MORE
Reviews	Wente SR, et al. (1997) "The nucleus and nucleocytoplasmic transport in Saccharomyces cerevisiae." Pp. 471-546 in The Molecular and Cellular Biology of the Yeast Saccharomyces: Cell Cycle and Cell Biology, edited by Pringle JR, Broach JR and Jones EW. Cold Spring Harbor, NY: Cold Spring Harbor Laboratory Press	|GLE1 |GLE2 |GSP1 |GSP2 |KAP95 |MTR2 |NIC96 |NPL3 |NSP1 |NTF2 |NUP1 |NUP100 |NUP116 |NUP120 |MORE
Cell Cycle Phase Involved Cellular Location	Winey M, et al. (1997) Nuclear pore complex number and distribution throughout the Saccharomyces cerevisiae cell cycle by three-dimensional reconstruction from electron micrographs of nuclear envelopes. Mol Biol Cell 8(11):2119-32	|NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP188 |NUP2 |NUP42 |NUP49 |MORE
Alias Cellular Location Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein-protein Interactions Strains/Constructs	Kenna MA, et al. (1996) Yeast N1e3p/Nup170p is required for normal stoichiometry of FG nucleoporins within the nuclear pore complex. Mol Cell Biol 16(5):2025-36	|NUP1 |NUP157 |NUP2 |NUP82 |RNA1 |SRP1 |YRB1
Reviews	Pante N and Aebi U (1996) Molecular dissection of the nuclear pore complex. Crit Rev Biochem Mol Biol 31(2):153-99	|ASM4 |NSP1 |NUP1 |NUP100 |NUP116 |NUP133 |NUP157 |NUP159 |NUP188 |NUP2 |NUP49 |NUP60 |POM152 |POM34
Cellular Location Cross-species Expression Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs	Aitchison JD, et al. (1995) Two novel related yeast nucleoporins Nup170p and Nup157p: complementation with the vertebrate homologue Nup155p and functional interactions with the yeast nuclear pore-membrane protein Pom152p. J Cell Biol 131(5):1133-48	|NIC96 |NUP157 |NUP188 |POM152
Reviews	Davis LI (1995) The nuclear pore complex. Annu Rev Biochem 64:865-96	|ASM4 |NSP1 |NUP1 |NUP100 |NUP116 |NUP133 |NUP157 |NUP159 |NUP188 |NUP2 |NUP49 |NUP60 |POM152 |POM34

Return to SGD

Send a Message to the SGD Curators