FUI1/YBL042C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrII: 140263 to 138344
CDS: 140263 - 138344

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

FUI1 YBL042C ORF, Verified S000000138

Description
High affinity uridine permease, localizes to the plasma membrane; also mediates low but significant transport of the cytotoxic nucleoside analog 5-fluorouridine; not involved in uracil transport

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
nucleobase transmembrane transporter activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR001248 , EBI:IPR012681
Assigned on 2007-05-23 UniProtKB
Tian W, et al. (2008) Combining guilt-by-association and guilt-by-profiling to predict Saccharomyces cerevisiae gene function. Genome Biol 9 Suppl 1:S7
             RCA : Reviewed Computational Analysis
Assigned on 2009-09-03 YeastFunc
uridine transmembrane transporter activity Vickers MF, et al. (2000) Nucleoside transporter proteins of Saccharomyces cerevisiae. Demonstration of a transporter (FUI1) with high uridine selectivity in plasma membranes and a transporter (FUN26) with broad nucleoside selectivity in intracellular membranes. J Biol Chem 275(34):25931-8
       IGI : Inferred from Genetic Interaction
IMP : Inferred from Mutant Phenotype
Assigned on 2002-09-19 SGD
Zhang J, et al. (2006) Characterization of the transport mechanism and permeant binding profile of the uridine permease Fui1p of Saccharomyces cerevisiae. J Biol Chem 281(38):28210-21
       IDA : Inferred from Direct Assay
Assigned on 2009-03-17 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
nucleobase, nucleoside, nucleotide and nucleic acid transport DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR001248 , EBI:IPR012681
Assigned on 2007-05-23 UniProtKB
regulation of protein catabolic process Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
transmembrane transport Vickers MF, et al. (2000) Nucleoside transporter proteins of Saccharomyces cerevisiae. Demonstration of a transporter (FUI1) with high uridine selectivity in plasma membranes and a transporter (FUN26) with broad nucleoside selectivity in intracellular membranes. J Biol Chem 275(34):25931-8
       IMP : Inferred from Mutant Phenotype
Assigned on 2008-12-09 SGD
DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR012681 , EBI:IPR001248
Assigned on 2009-10-01 UniProtKB
transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0813
Assigned on 2007-05-23 UniProtKB
uridine transport Vickers MF, et al. (2000) Nucleoside transporter proteins of Saccharomyces cerevisiae. Demonstration of a transporter (FUI1) with high uridine selectivity in plasma membranes and a transporter (FUN26) with broad nucleoside selectivity in intracellular membranes. J Biol Chem 275(34):25931-8
       IGI : Inferred from Genetic Interaction
IMP : Inferred from Mutant Phenotype
Assigned on 2002-09-19 SGD
Zhang J, et al. (2006) Characterization of the transport mechanism and permeant binding profile of the uridine permease Fui1p of Saccharomyces cerevisiae. J Biol Chem 281(38):28210-21
       IMP : Inferred from Mutant Phenotype
IDA : Inferred from Direct Assay
Assigned on 2009-03-17 SGD
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR012681 , EBI:IPR001248
Assigned on 2009-06-17 UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2009-06-29 UniProtKB
plasma membrane Vickers MF, et al. (2000) Nucleoside transporter proteins of Saccharomyces cerevisiae. Demonstration of a transporter (FUI1) with high uridine selectivity in plasma membranes and a transporter (FUN26) with broad nucleoside selectivity in intracellular membranes. J Biol Chem 275(34):25931-8
       IGI : Inferred from Genetic Interaction
IMP : Inferred from Mutant Phenotype
Assigned on 2002-09-19 SGD
Zhang J, et al. (2006) Characterization of the transport mechanism and permeant binding profile of the uridine permease Fui1p of Saccharomyces cerevisiae. J Biol Chem 281(38):28210-21
       IDA : Inferred from Direct Assay
Assigned on 2009-03-17 SGD

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
SUMMARY PARAGRAPH for FUI1/YBL042C for FUI1
Fui1p is a uridine permease located in the plasma membrane. It has high affinity and selectivity for uridine (1, 2, 3), and does not transport uracil or allantoin into the cell (4, 3).
fui1 null mutants are viable, and are resistant to 5-fluorouridine, but do not grow on medium containing uridine as the sole source of pyrimidines (5, 3, 2). In a large-scale synthetic genetic array analysis, fui1 mutations also cause synthetic growth defects in combination with mutations in either LAS21, which encodes a plasma membrane protein involved in glycosylphosphatidylinositol synthesis, or RIC1, which encodes a protein involved in retrograde transport to the cis-Golgi network (6). Fui1p is able to transport uracil when it is overexpressed, and overexpression of Fui1p results in a decreased growth rate in the presence of uridine (3, 4).
Fui1p is degraded via ubiquitination, endocytosis, and then vacuolar degradation (7, 4). Uridine promotes Rsp5p-dependent ubiquitination of Fui1p at the plasma membrane, followed by its endocytosis and then vacuolar degradation (4). In cells being exposed to toxic levels of uridine, uridine is also able to direct Fui1p for early vacuolar degradation immediately after synthesis, without prior localization of Fui1p to the plasma membrane (4).
FUI1 belongs to a family of uracil/uridine/allantoin permease homologs, and has similarity to DAL4, FUR4, THI7, and YOR071C, and Schizosaccharomyces pombe fur4 (8, 9, 10, 3, 11, 12).
Last Updated: 2005-12-14

Basic References [TOP]
BASIC INFORMATION REFERENCES forFUI1/YBL042C for FUI1
1) Vickers MF, et al. (2000) Nucleoside transporter proteins of Saccharomyces cerevisiae. Demonstration of a transporter (FUI1) with high uridine selectivity in plasma membranes and a transporter (FUN26) with broad nucleoside selectivity in intracellular membranes. J Biol Chem 275(34):25931-8

2) Jund R and Lacroute F (1970) Genetic and physiological aspects of resistance to 5-fluoropyrimidines in Saccharomyces cerevisiae. J Bacteriol 102(3):607-15

3) Wagner R, et al. (1998) The ORF YBL042 of Saccharomyces cerevisiae encodes a uridine permease. FEMS Microbiol Lett 159(1):69-75

4) Blondel MO, et al. (2004) Direct sorting of the yeast uracil permease to the endosomal system is controlled by uracil binding and Rsp5p-dependent ubiquitylation. Mol Biol Cell 15(2):883-95

5) Malagon F and Aguilera A (1999) Construction and genetic analysis of S. cerevisiae deletants of six novel ORFs from chromosome II. Yeast 15(10B):955-61

6) Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13

7) Rotin D, et al. (2000) Ubiquitination and endocytosis of plasma membrane proteins: role of Nedd4/Rsp5p family of ubiquitin-protein ligases. J Membr Biol 176(1):1-17

8) de Montigny J, et al. (1998) The uracil permease of Schizosaccharomyces pombe: a representative of a family of 10 transmembrane helix transporter proteins of yeasts. Yeast 14(11):1051-9

9) De Wergifosse P, et al. (1994) The sequence of a 22.4 kb DNA fragment from the left arm of yeast chromosome II reveals homologues to bacterial proline synthetase and murine alpha-adaptin, as well as a new permease and a DNA-binding protein. Yeast 10(11):1489-96

10) Marchal C, et al. (1998) A PEST-like sequence mediates phosphorylation and efficient ubiquitination of yeast uracil permease. Mol Cell Biol 18(1):314-21

11) Nelissen B, et al. (1995) Phylogenetic classification of the major superfamily of membrane transport facilitators, as deduced from yeast genome sequencing. FEBS Lett 377(2):232-6

12) Nelissen B, et al. (1997) Classification of all putative permeases and other membrane plurispanners of the major facilitator superfamily encoded by the complete genome of Saccharomyces cerevisiae. FEMS Microbiol Rev 21(2):113-34

13) Zhang J, et al. (2006) Characterization of the transport mechanism and permeant binding profile of the uridine permease Fui1p of Saccharomyces cerevisiae. J Biol Chem 281(38):28210-21

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for FUI1/YBL042C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for FUI1/YBL042C

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MPVSDSG

C-term YEKIRYI

Length(aa) 639

MW(Da) 72,164

pI 7.47

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.174

Codon Adaptation Index 0.168

Frequency of Optimal Codons 0.516

Hydropathicity of Protein 0.191

Aromaticity Score 0.155

10 20 30 40 50 | | | | | MPVSDSGFDNSSKTMKDDTIPTEDYEEITKESEMGDATKITSKIDANVIE KKDTDSENNITIAQDDEKVSWLQRVVEFFEVKNDSTDLADHKPENPIRTF KDLQESLRSTYLYNTDLRPVEAKRRTWTWKQYIFFWISGSFNVNTWQISA TGLQLGLNWWQTWICIWVGYTFVAFFLILGSKVGNNYHISFPISSRVSFG IYFSIWIVINRVVMACVWNSTLAYIGSQCVQLMLKAIFGTNLNTRIKDTI KNPNLTNFEFMCFMVFWVACLPFLWFPPDKLRHIFALKSAITPFAAFGFL IWTLCKAKGHLALGSLNDNGGAISKTVLAWSVIRAIMSALDNFSTLILNA PDFTRFGKTYKSSVYSQLIALPVCYAIISLIGILSVSAAYTLYGVNYWSP LDILNRYLDNYTSGNRAGVFLISFIFAFDQLGANLSGNSIPAGTDLTALL PKFINIRRGSYICALISLAICPWDLLSSSSKFTTALAAYAVFLSAIAGVI SADYFIVRKGYVNIFHCYTDKPGSYYMYNKYGTNWRAVVAYIFGIAPNFA GFLGSVGVSVPIGAMKVYYLNYFVGYLLAALSYCILVYFYPIKGIPGDAK ITDRKWLEEWVEVEEFGTEREAFEEYGGVSTGYEKIRYI*

Protein Structures from PDB: proteins of known structure with sequence similarity to FUI1/YBL042C, based on Smith-Waterman analysis. [TOP] [NEXT]
PDB protein structure(s) homologous to FUI1 Homolog Source (per PDB) Protein Alignment: FUI1 vs. Homolog External Links
P-Value %Identical %Similar Alignment
2jlo ( Chain: A)
Structure of mhp1, a nucleobase-cation-symport-1 family transporter, in a closed conformation with benzylhydantoin
PDB_Info
PDB_Structure
Microbacterium liquefaciens 1.3e-14 22 33 View alignment SCOP
MMDB
CATH
2jln ( Chain: A)
Structure of mhp1, a nucleobase-cation-symport-1 family transporter
PDB_Info
PDB_Structure
Microbacterium liquefaciens 1.3e-14 22 33 View alignment SCOP
MMDB
CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
FUI1 SGD (2007) Information without a citation in SGD

Standard Name	Reference
FUI1	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YBL042C SGD Systematic Sequence

852238 NCBI: Gene ID

NP_009511.1 NCBI: RefSeq protein version ID

NP_009511.1 NCBI: RefSeq protein version ID

6319429 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YBL042C	SGD Systematic Sequence
852238	NCBI: Gene ID
NP_009511.1	NCBI: RefSeq protein version ID
NP_009511.1	NCBI: RefSeq protein version ID
6319429	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
24 curated references; 0 references not yet curated
Evolution
Fungal Related Genes/Proteins
Hamari Z, et al. (2009) Convergent evolution and orphan genes in the Fur4p-like family and characterization of a general nucleoside transporter in Aspergillus nidulans. Mol Microbiol 73(1):43-57
       |DAL4 |FCY2 |FCY21 |FCY22 |FUN26 |FUR4 |NRT1 |THI7 |THI72 |TPN1
Regulation of
Zhang Z, et al. (2009) Positive selection for elevated gene expression noise in yeast. Mol Syst Biol 5:299
       |AGP1 |AQR1 |DIP5 |FCY2 |FET4 |FTR1 |HXT2 |HXT3 |MUP1 |OPT1 |QDR2 |SAM3 |THI7 |TPO1 |MORE
Mutants/Phenotypes
McCue PP and Phang JM (2008) Identification of Human Intracellular Targets of the Medicinal Herb St. John's Wort by Chemical-Genetic Profiling in Yeast. J Agric Food Chem 56(22):11011-11017
       |ABD1 |ACS1 |ADP1 |AHC1 |APN2 |ASR1 |ATP5 |BCK2 |BFR1 |CBP6 |CHK1 |CIN8 |CRR1 |CTF19 |MORE
Mutants/Phenotypes
Fairn GD, et al. (2007) A chemogenomic screen in Saccharomyces cerevisiae uncovers a primary role for the mitochondria in farnesol toxicity and its regulation by the Pkc1 pathway. J Biol Chem 282(7):4868-74
         |AIM21 |ARG4 |BCK1 |CBP1 |CLA4 |COR1 |COX11 |DAL5 |ECM33 |EOS1 |ERG6 |FSF1 |FUR4 |FYV6 |MORE
Evolution
Fungal Related Genes/Proteins
De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81
       |AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Fungal Related Genes/Proteins
Paluszynski JP, et al. (2006) Various cytosine/adenine permease homologues are involved in the toxicity of 5-fluorocytosine in Saccharomyces cerevisiae. Yeast 23(9):707-15
       |DAL4 |FCY1 |FCY2 |FCY21 |FCY22 |FUR4 |NRT1 |TPN1
Cross-species Expression
Function/Process
Mutants/Phenotypes
Protein Physical Properties
Protein Sequence Features
Protein/Nucleic Acid Structure
Strains/Constructs
Substrates/Ligands/Cofactors
Zhang J, et al. (2006) Characterization of the transport mechanism and permeant binding profile of the uridine permease Fui1p of Saccharomyces cerevisiae. J Biol Chem 281(38):28210-21
       |FUR4
RNA Levels and Processing
Regulation of
Lai LC, et al. (2005) Dynamical remodeling of the transcriptome during short-term anaerobiosis in Saccharomyces cerevisiae: differential response and role of Msn2 and/or Msn4 and other factors in galactose and glucose media. Mol Cell Biol 25(10):4075-91
         |AAC1 |ADE1 |ADE12 |ADE17 |ADE4 |AFR1 |AIM17 |AIM3 |AKR1 |AKR2 |ALA1 |ALD5 |ARE1 |ARN1 |MORE
Cellular Location
Genetic Interactions
Mutants/Phenotypes
Protein Processing/Modification/Regulation
Strains/Constructs
Blondel MO, et al. (2004) Direct sorting of the yeast uracil permease to the endosomal system is controlled by uracil binding and Rsp5p-dependent ubiquitylation. Mol Biol Cell 15(2):883-95
       |END3 |FUR4 |PEP12 |PEP4 |RSP5
Genetic Interactions
Strains/Constructs
Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13
           |AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
RNA Levels and Processing
Regulation of
Epstein CB, et al. (2001) Genome-wide responses to mitochondrial dysfunction. Mol Biol Cell 12(2):297-308
         |ACO1 |ACS1 |ADH2 |ADY2 |AGP1 |AGP2 |ALD4 |ALT1 |ATO3 |BAT2 |BIO2 |CAR1 |CDA1 |CIT1 |MORE
Function/Process
Reviews
Vickers MF, et al. (2001) Functional production of mammalian concentrative nucleoside transporters in Saccharomyces cerevisiae. Mol Membr Biol 18(1):73-9
       |FUR4
Cellular Location
Protein Processing/Modification/Regulation
Reviews
Rotin D, et al. (2000) Ubiquitination and endocytosis of plasma membrane proteins: role of Nedd4/Rsp5p family of ubiquitin-protein ligases. J Membr Biol 176(1):1-17
       |DAL5 |FUR4 |GAL2 |GAP1 |GNP1 |HXT6 |HXT7 |ITR1 |MAL11 |MAL61 |PDR5 |PUT4 |RSP5 |STE2 |MORE
Function/Process
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Strains/Constructs
Vickers MF, et al. (2000) Nucleoside transporter proteins of Saccharomyces cerevisiae. Demonstration of a transporter (FUI1) with high uridine selectivity in plasma membranes and a transporter (FUN26) with broad nucleoside selectivity in intracellular membranes. J Biol Chem 275(34):25931-8
       |FUN26
Mutants/Phenotypes
Strains/Constructs
Malagon F and Aguilera A (1999) Construction and genetic analysis of S. cerevisiae deletants of six novel ORFs from chromosome II. Yeast 15(10B):955-61
       |APN2 |ECM13 |NCL1 |POP8 |PSY4
Function/Process
Fungal Related Genes/Proteins
Protein Sequence Features
Pinson B, et al. (1999) Only one of the charged amino acids located in membrane-spanning regions is important for the function of the Saccharomyces cerevisiae uracil permease. Biochem J 339 ( Pt 1)():37-42
       |FUR4
Alias
Fungal Related Genes/Proteins
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Wagner R, et al. (1998) The ORF YBL042 of Saccharomyces cerevisiae encodes a uridine permease. FEMS Microbiol Lett 159(1):69-75
       |DAL4 |FUR4
Fungal Related Genes/Proteins
Protein Sequence Features
de Montigny J, et al. (1998) The uracil permease of Schizosaccharomyces pombe: a representative of a family of 10 transmembrane helix transporter proteins of yeasts. Yeast 14(11):1051-9
       |DAL4 |FUR4 |NRT1 |THI7
Reviews
Nelissen B, et al. (1997) Classification of all putative permeases and other membrane plurispanners of the major facilitator superfamily encoded by the complete genome of Saccharomyces cerevisiae. FEMS Microbiol Rev 21(2):113-34
       |BAP3 |DIP5 |FUR4 |HIP1 |MEP1 |SEO1 |SNF3 |SSY1 |YCT1 |YIL166C
Reviews
Andre B (1995) An overview of membrane transport proteins in Saccharomyces cerevisiae. Yeast 11(16):1575-611
     |CCC2 |COT1 |CTR1 |DIP5 |ESBP6 |FEN2 |MEP1 |MEP2 |NHX1 |PCA1 |PDR10 |PDR15 |PHO84 |PHO87 |MORE
Fungal Related Genes/Proteins
Nelissen B, et al. (1995) Phylogenetic classification of the major superfamily of membrane transport facilitators, as deduced from yeast genome sequencing. FEBS Lett 377(2):232-6
       |DAL4 |DUR3 |FCY2 |FEN2 |FUR4 |HOL1 |HXT11 |HXT12 |HXT17 |HXT9 |PHO84 |PTR2 |SGE1 |SNF3 |MORE
Alias
DNA/RNA Sequence Features
Fungal Related Genes/Proteins
Mapping
De Wergifosse P, et al. (1994) The sequence of a 22.4 kb DNA fragment from the left arm of yeast chromosome II reveals homologues to bacterial proline synthetase and murine alpha-adaptin, as well as a new permease and a DNA-binding protein. Yeast 10(11):1489-96
     |COR1 |DAL4 |EDE1 |ERD2 |FUR4 |PRE7 |UBP5 |URA7
DNA/RNA Sequence Features
Mapping
Feldmann H, et al. (1994) Complete DNA sequence of yeast chromosome II. EMBO J 13(24):5795-809
     |ALG3 |AST1 |CDS1 |CHS3 |CMD1 |COQ1 |COR1 |CST26 |CTP1 |DER1 |DUR1,2 |ECM1 |FIG1 |FUR4 |MORE
Function/Process
Jund R and Lacroute F (1970) Genetic and physiological aspects of resistance to 5-fluoropyrimidines in Saccharomyces cerevisiae. J Bacteriol 102(3):607-15
     |FUR4

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.