ERD2/YBL040C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrII: 142871 to 142115
intron: 142849 - 142753
CDS: 142871 - 142850, 142752 - 142115

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

ERD2 YBL040C ORF, Verified S000000136

Description
HDEL receptor, an integral membrane protein that binds to the HDEL motif in proteins destined for retention in the endoplasmic reticulum; has a role in maintenance of normal levels of ER-resident proteins

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
ER retention sequence binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR000133
Assigned on 2007-05-23 UniProtKB
HDEL sequence binding Semenza JC, et al. (1990) ERD2, a yeast gene required for the receptor-mediated retrieval of luminal ER proteins from the secretory pathway. Cell 61(7):1349-57
       IGI : Inferred from Genetic Interaction
IPI : Inferred from Physical Interaction
IMP : Inferred from Mutant Phenotype
Assigned on 2002-08-02 SGD
receptor activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0675
Assigned on 2007-05-23 UniProtKB
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
ER to Golgi vesicle-mediated transport Lewis MJ, et al. (1990) The ERD2 gene determines the specificity of the luminal ER protein retention system. Cell 61(7):1359-63
       IMP : Inferred from Mutant Phenotype
Assigned on 2007-01-25 SGD
Aoe T, et al. (1997) The KDEL receptor, ERD2, regulates intracellular traffic by recruiting a GTPase-activating protein for ARF1. EMBO J 16(24):7305-16
       IMP : Inferred from Mutant Phenotype
Assigned on 2007-01-25 SGD
protein retention in ER lumen Lewis MJ, et al. (1990) The ERD2 gene determines the specificity of the luminal ER protein retention system. Cell 61(7):1359-63
       IGI : Inferred from Genetic Interaction
Assigned on 2002-08-02 SGD
DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR000133
Assigned on 2007-05-23 UniProtKB
protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0653
Assigned on 2007-05-23 UniProtKB
transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0813
Assigned on 2007-05-23 UniProtKB
vesicle-mediated transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0931
Assigned on 2008-02-14 UniProtKB
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
endoplasmic reticulum GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23 UniProtKB
integral to endoplasmic reticulum membrane Semenza JC, et al. (1990) ERD2, a yeast gene required for the receptor-mediated retrieval of luminal ER proteins from the secretory pathway. Cell 61(7):1349-57
       IDA : Inferred from Direct Assay
Assigned on 2002-08-02 SGD
integral to membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR000133
Assigned on 2007-05-23 UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forERD2/YBL040C for ERD2
1) Semenza JC, et al. (1990) ERD2, a yeast gene required for the receptor-mediated retrieval of luminal ER proteins from the secretory pathway. Cell 61(7):1349-57

2) Hardwick KG, et al. (1990) ERD1, a yeast gene required for the retention of luminal endoplasmic reticulum proteins, affects glycoprotein processing in the Golgi apparatus. EMBO J 9(3):623-30

3) Beh CT and Rose MD (1995) Two redundant systems maintain levels of resident proteins within the yeast endoplasmic reticulum. Proc Natl Acad Sci U S A 92(21):9820-3

4) Lewis MJ and Pelham HR (1990) A human homologue of the yeast HDEL receptor. Nature 348(6297):162-3

5) Pelham HR, et al. (1988) Sorting of soluble ER proteins in yeast. EMBO J 7(6):1757-62

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for ERD2/YBL040C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for ERD2/YBL040C

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MNPFRIL

C-term KGFKLPK

Length(aa) 219

MW(Da) 25,762

pI 10.62

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.199

Codon Adaptation Index 0.182

Frequency of Optimal Codons 0.527

Hydropathicity of Protein 0.411

Aromaticity Score 0.174

10 20 30 40 50 | | | | | MNPFRILGDLSHLTSILILIHNIKTTRYIEGISFKTQTLYALVFITRYLD LLTFHWVSLYNALMKIFFIVSTAYIVVLLQGSKRTNTIAYNEMLMHDTFK IQHLLIGSALMSVFFHHKFTFLELAWSFSVWLESVAILPQLYMLSKGGKT RSLTVHYIFAMGLYRALYIPNWIWRYSTEDKKLDKIAFFAGLLQTLLYSD FFYIYYTKVIRGKGFKLPK*

Protein Structures from PDB: proteins of known structure with sequence similarity to ERD2/YBL040C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
ERD2 Semenza JC, et al. (1990) ERD2, a yeast gene required for the receptor-mediated retrieval of luminal ER proteins from the secretory pathway. Cell 61(7):1349-57

Hardwick KG, et al. (1990) ERD1, a yeast gene required for the retention of luminal endoplasmic reticulum proteins, affects glycoprotein processing in the Golgi apparatus. EMBO J 9(3):623-30

Standard Name	Reference
ERD2	*Semenza JC, et al.* (1990)** ERD2, a yeast gene required for the receptor-mediated retrieval of luminal ER proteins from the secretory pathway. Cell 61(7):1349-57 *Hardwick KG, et al.* (1990)** ERD1, a yeast gene required for the retention of luminal endoplasmic reticulum proteins, affects glycoprotein processing in the Golgi apparatus. EMBO J 9(3):623-30

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YBL040C SGD Systematic Sequence

852240 NCBI: Gene ID

NP_009513.1 NCBI: RefSeq protein version ID

NP_009513.1 NCBI: RefSeq protein version ID

6319431 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YBL040C	SGD Systematic Sequence
852240	NCBI: Gene ID
NP_009513.1	NCBI: RefSeq protein version ID
NP_009513.1	NCBI: RefSeq protein version ID
6319431	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
31 curated references; 0 references not yet curated
Evolution
Non-Fungal Related Genes/Proteins
Tischler J, et al. (2006) Combinatorial RNA interference in Caenorhabditis elegans reveals that redundancy between gene duplicates can be maintained for more than 80 million years of evolution. Genome Biol 7(8):R69
       |AAT2 |AGC1 |AIP1 |ALE1 |APM1 |ARC15 |BNA3 |BNA4 |BSC1 |BZZ1 |CDC36 |CDC53 |CKS1 |CMD1 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Davierwala AP, et al. (2005) The synthetic genetic interaction spectrum of essential genes. Nat Genet 37(10):1147-52
           |ABD1 |ACT1 |ALG13 |ALG14 |ALG7 |APC11 |ARL3 |ARP2 |ARP7 |ASK1 |AVO1 |BET3 |BET5 |BIM1 |MORE
Protein-protein Interactions
Miller JP, et al. (2005) Large-scale identification of yeast integral membrane protein interactions. Proc Natl Acad Sci U S A 102(34):12123-8
       |ARV1 |EMP24 |EMP46 |EMP47 |ERD1 |ERG11 |ERP5 |ERV29 |ERV41 |MST27 |PHO84 |PHO88 |SEC61 |SHR3 |MORE
Cross-species Expression
Function/Process
Genetic Interactions
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Pfluger SL, et al. (2005) Receptor for retrograde transport in the apicomplexan parasite Toxoplasma gondii. Eukaryot Cell 4(2):432-42

Cellular Location
Function/Process
Protein-protein Interactions
Andag U, et al. (2001) The coatomer-interacting protein Dsl1p is required for Golgi-to-endoplasmic reticulum retrieval in yeast. J Biol Chem 276(42):39150-60
       |COP1 |DSL1 |KAR2 |SEC20 |SEC22 |TIP20
Function/Process
Belden WJ and Barlowe C (2001) Deletion of yeast p24 genes activates the unfolded protein response. Mol Biol Cell 12(4):957-69
       |EMP24 |ERV25 |IRE1 |KAR2
DNA/RNA Sequence Features
Davis CA, et al. (2000) Test of intron predictions reveals novel splice sites, alternatively spliced mRNAs and new introns in meiotically regulated genes of yeast. Nucleic Acids Res 28(8):1700-6
       |AIM11 |AMA1 |AML1 |APE2 |APS3 |ARP9 |ASC1 |BET1 |BIG1 |BOS1 |CDC21 |COF1 |DCN1 |DID4 |MORE
Function/Process
Mutants/Phenotypes
Other Features
Strains/Constructs
Eisfeld K, et al. (2000) Endocytotic uptake and retrograde transport of a virally encoded killer toxin in yeast. Mol Microbiol 37(4):926-40
       |CNE1 |END3 |ERD1 |KAR2 |KEX1 |SEC61 |SLA2
Function/Process
Mutants/Phenotypes
Strains/Constructs
Reggiori F and Conzelmann A (1998) Biosynthesis of inositol phosphoceramides and remodeling of glycosylphosphatidylinositol anchors in Saccharomyces cerevisiae are mediated by different enzymes. J Biol Chem 273(46):30550-9
       |AUR1 |IPT1 |SEC21
Function/Process
Mutants/Phenotypes
Protein-protein Interactions
Regulatory Role
Strains/Constructs
Aoe T, et al. (1997) The KDEL receptor, ERD2, regulates intracellular traffic by recruiting a GTPase-activating protein for ARF1. EMBO J 16(24):7305-16
       |ARF1
Non-Fungal Related Genes/Proteins
Llewellyn DH, et al. (1997) KDEL receptor expression is not coordinatedly up-regulated with ER stress-induced reticuloplasmin expression in HeLa cells. Biochem Biophys Res Commun 240(1):36-40
       |KAR2
Genetic Interactions
Seidel J and Tanner W (1997) Characterization of two new genes down-regulated by alpha-factor. Yeast 13(9):809-17
       |CCW12 |HOR7 |SED1
Cellular Location
Lewis MJ and Pelham HR (1996) SNARE-mediated retrograde traffic from the Golgi complex to the endoplasmic reticulum. Cell 85(2):205-15
       |SEC20 |SEC21 |UFE1
Function/Process
Fungal Related Genes/Proteins
Beh CT and Rose MD (1995) Two redundant systems maintain levels of resident proteins within the yeast endoplasmic reticulum. Proc Natl Acad Sci U S A 92(21):9820-3
       |IRE1 |KAR2
DNA/RNA Sequence Features
Mapping
De Wergifosse P, et al. (1994) The sequence of a 22.4 kb DNA fragment from the left arm of yeast chromosome II reveals homologues to bacterial proline synthetase and murine alpha-adaptin, as well as a new permease and a DNA-binding protein. Yeast 10(11):1489-96
     |COR1 |DAL4 |EDE1 |FUI1 |FUR4 |PRE7 |UBP5 |URA7
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Hardwick KG and Pelham HR (1994) SED6 is identical to ERG6, and encodes a putative methyltransferase required for ergosterol synthesis. Yeast 10(2):265-9
     |ERG6
Mutants/Phenotypes
Strains/Constructs
Townsley FM, et al. (1994) Retrieval of HDEL proteins is required for growth of yeast cells. J Cell Biol 127(1):21-8
     |KAR2
Cellular Location
Function/Process
Non-Fungal Related Genes/Proteins
Elmendorf HG and Haldar K (1993) Identification and localization of ERD2 in the malaria parasite Plasmodium falciparum: separation from sites of sphingomyelin synthesis and implications for organization of the Golgi. EMBO J 12(12):4763-73
     |KAR2
Cross-species Expression
Non-Fungal Related Genes/Proteins
Lee HI, et al. (1993) The Arabidopsis endoplasmic reticulum retention receptor functions in yeast. Proc Natl Acad Sci U S A 90(23):11433-7

Non-Fungal Related Genes/Proteins
Tang BL, et al. (1993) Molecular cloning, characterization, subcellular localization and dynamics of p23, the mammalian KDEL receptor. J Cell Biol 120(2):325-38

Genetic Interactions
Hardwick KG and Pelham HR (1992) SED5 encodes a 39-kD integral membrane protein required for vesicular transport between the ER and the Golgi complex. J Cell Biol 119(3):513-21
     |SED5
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Hardwick KG, et al. (1992) Genes that allow yeast cells to grow in the absence of the HDEL receptor. EMBO J 11(11):4187-95
     |DPM1 |KAR2 |SEC12 |SED1 |SED4
Mapping
Lee DH, et al. (1992) PRS3 encoding an essential subunit of yeast proteasomes homologous to mammalian proteasome subunit C5. Biochem Biophys Res Commun 182(2):452-60
     |PRE10 |PRE7
Non-Fungal Related Genes/Proteins
Lewis MJ and Pelham HR (1992) Ligand-induced redistribution of a human KDEL receptor from the Golgi complex to the endoplasmic reticulum. Cell 68(2):353-64

Non-Fungal Related Genes/Proteins
Lewis MJ and Pelham HR (1992) Sequence of a second human KDEL receptor. J Mol Biol 226(4):913-6

Reviews
Pryer NK, et al. (1992) Vesicle-mediated protein sorting. Annu Rev Biochem 61:471-516
     |ARF1 |ARF2 |BET1 |BET2 |BOS1 |CHC1 |CLC1 |ERD1 |SAR1 |SEC1 |SEC12 |SEC13 |SEC14 |SEC15 |MORE
Function/Process
Fungal Related Genes/Proteins
Mutants/Phenotypes
Protein Sequence Features
Semenza JC and Pelham HR (1992) Changing the specificity of the sorting receptor for luminal endoplasmic reticulum proteins. J Mol Biol 224(1):1-5

Fungal Related Genes/Proteins
Mutants/Phenotypes
Strains/Constructs
Hardwick KG, et al. (1990) ERD1, a yeast gene required for the retention of luminal endoplasmic reticulum proteins, affects glycoprotein processing in the Golgi apparatus. EMBO J 9(3):623-30
     |ERD1 |KAR2
Non-Fungal Related Genes/Proteins
Lewis MJ and Pelham HR (1990) A human homologue of the yeast HDEL receptor. Nature 348(6297):162-3

Function/Process
Fungal Related Genes/Proteins
Genetic Interactions
Lewis MJ, et al. (1990) The ERD2 gene determines the specificity of the luminal ER protein retention system. Cell 61(7):1359-63
       |KAR2
Cellular Location
Function/Process
Mutants/Phenotypes
Protein Sequence Features
Strains/Constructs
Semenza JC, et al. (1990) ERD2, a yeast gene required for the receptor-mediated retrieval of luminal ER proteins from the secretory pathway. Cell 61(7):1349-57

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.