PET9/YBL030C Single Page Format

Help

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

SGD Locus Page

Names and Identifiers [TOP] [NEXT] Help
Standard Name Systematic Name Alias Feature Type SGDID
PET9 YBL030C AAC2, ANC2, OP1 ORF, Verified S000000126
Description
Major ADP/ATP carrier of the mitochondrial inner membrane, exchanges cytosolic ADP for mitochondrially synthesized ATP; phosphorylated; required for viability in many common lab strains carrying a mutation in the polymorphic SAL1 gene

GO Annotations [TOP] [NEXT] Help
Molecular Function
Annotation(s)Reference(s)EvidenceAssigned By
ATP:ADP antiporter activityBrandolin G, et al. (1993) Biochemical characterisation of the isolated Anc2 adenine nucleotide carrier from Saccharomyces cerevisiae mitochondria. Biochem Biophys Res Commun 192(1):143-50
SGD Papers Entry  Pubmed Entry  
IDA : Inferred from Direct Assay
Assigned on 2001-02-13
SGD
bindingDDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:IPR001993 , EBI:IPR002067
Assigned on 2007-05-23
UniProtKB
substrate-specific transmembrane transporter activityTian W, et al. (2008) Combining guilt-by-association and guilt-by-profiling to predict Saccharomyces cerevisiae gene function. Genome Biol 9 Suppl 1:S7
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  Reference LINKOUT  Reference LINKOUT  
RCA : Reviewed Computational Analysis
Assigned on 2009-09-03
YeastFunc
transporter activityDDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:IPR002113
Assigned on 2007-05-23
UniProtKB
Biological Process
Annotation(s)Reference(s)EvidenceAssigned By
ADP transportBrandolin G, et al. (1993) Biochemical characterisation of the isolated Anc2 adenine nucleotide carrier from Saccharomyces cerevisiae mitochondria. Biochem Biophys Res Commun 192(1):143-50
SGD Papers Entry  Pubmed Entry  
IDA : Inferred from Direct Assay
Assigned on 2007-03-08
SGD
ATP transportBrandolin G, et al. (1993) Biochemical characterisation of the isolated Anc2 adenine nucleotide carrier from Saccharomyces cerevisiae mitochondria. Biochem Biophys Res Commun 192(1):143-50
SGD Papers Entry  Pubmed Entry  
IDA : Inferred from Direct Assay
Assigned on 2007-03-08
SGD
aerobic respirationGawaz M, et al. (1990) Structure-function studies of adenine nucleotide transport in mitochondria. II. Biochemical analysis of distinct AAC1 and AAC2 proteins in yeast. J Biol Chem 265(24):14202-8
SGD Papers Entry  Pubmed Entry  
IMP : Inferred from Mutant Phenotype
Assigned on 2004-02-26
SGD
anaerobic respirationDrgon T, et al. (1991) ADP/ATP translocator is essential only for anaerobic growth of yeast Saccharomyces cerevisiae. FEBS Lett 289(2):159-62
SGD Papers Entry  Pubmed Entry  
IGI : Inferred from Genetic Interaction with SGD:AAC3
Assigned on 2004-02-26
SGD
apoptosisPereira C, et al. (2007) ADP/ATP carrier is required for mitochondrial outer membrane permeabilization and cytochrome c release in yeast apoptosis. Mol Microbiol 66(3):571-82
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  SGD Curated Comments & Errata
IMP : Inferred from Mutant Phenotype
Assigned on 2009-10-09
SGD
heme biosynthetic processAzuma M, et al. (2008) Adenine nucleotide translocator transports haem precursors into mitochondria. PLoS ONE 3(8):e3070
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  
IGI : Inferred from Genetic Interaction with SGD:AAC1, SGD:AAC3
Assigned on 2008-09-09
SGD
ion transportHuttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
SGD Papers Entry  
RCA : Reviewed Computational Analysis
Assigned on 2009-08-06
bioPIXIE_MEFIT
mitochondrial transportGawaz M, et al. (1990) Structure-function studies of adenine nucleotide transport in mitochondria. II. Biochemical analysis of distinct AAC1 and AAC2 proteins in yeast. J Biol Chem 265(24):14202-8
SGD Papers Entry  Pubmed Entry  
IMP : Inferred from Mutant Phenotype
Assigned on 2004-02-26
SGD
nucleotide metabolic processHuttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
SGD Papers Entry  
RCA : Reviewed Computational Analysis
Assigned on 2009-08-06
bioPIXIE_MEFIT
oxidation reductionHuttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
SGD Papers Entry  
RCA : Reviewed Computational Analysis
Assigned on 2009-08-06
bioPIXIE_MEFIT
transmembrane transportBrandolin G, et al. (1993) Biochemical characterisation of the isolated Anc2 adenine nucleotide carrier from Saccharomyces cerevisiae mitochondria. Biochem Biophys Res Commun 192(1):143-50
SGD Papers Entry  Pubmed Entry  
IDA : Inferred from Direct Assay
Assigned on 2008-12-09
SGD
DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:IPR002067 , EBI:IPR002113 , EBI:IPR001993
Assigned on 2009-10-01
UniProtKB
transportDDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:IPR001993 , EBI:IPR002067 , EBI:IPR002113
Assigned on 2007-05-23
UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:KW-0813
Assigned on 2007-05-23
UniProtKB
Cellular Component
Annotation(s)Reference(s)EvidenceAssigned By
integral to membraneGOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23
UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01
UniProtKB
membraneDDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:IPR001993
Assigned on 2007-05-23
UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23
UniProtKB
mitochondrial inner membraneLauquin G, et al. (1976) Effect of genetic and physiological manipulations onthe kinetic and binding parameters of the adenine nucleotide translocator in Saccharomyces cervisiae and Candida utilis. Biochimie 58(10):1213-20
SGD Papers Entry  Pubmed Entry  
IDA : Inferred from Direct Assay
Assigned on 2001-01-18
SGD
DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:IPR002067 , EBI:IPR002113
Assigned on 2009-06-17
UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:KW-0999
Assigned on 2009-06-29
UniProtKB
mitochondrionReinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Web Supplement  yfgdb  
IDA : Inferred from Direct Assay
Assigned on 2006-12-12
SGD
Brandina I, et al. (2006) Enolase takes part in a macromolecular complex associated to mitochondria in yeast. Biochim Biophys Acta 1757(9-10):1217-1228
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
IPI : Inferred from Physical Interaction with SGD:ENO1, SGD:ENO2
Assigned on 2007-03-05
SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
SGD Papers Entry  Reference full text  
IEA : Inferred from Electronic Annotation with EBI:KW-0496
Assigned on 2007-05-23
UniProtKB

Pathways [TOP] [NEXT] Help
No pathways available

Summary Paragraph [TOP] [NEXT] Help
No summary paragraph available

Basic References [TOP]   Help
BASIC INFORMATION REFERENCES forPET9/YBL030C for PET9
1)Adrian GS, et al. (1986) Sequences required for delivery and localization of the ADP/ATP translocator to the mitochondrial inner membrane. Mol Cell Biol 6(2):626-34
SGD Papers Entry  Pubmed Entry  
2)Chen XJ (2004) Sal1p, a calcium-dependent carrier protein that suppresses an essential cellular function associated With the Aac2 isoform of ADP/ATP translocase in Saccharomyces cerevisiae. Genetics 167(2):607-17
SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
3)Reinders J, et al. (2007) Profiling phosphoproteins of yeast mitochondria reveals a role of phosphorylation in assembly of the ATP synthase. Mol Cell Proteomics 6(11):1896-906
SGD Papers Entry  Pubmed Entry  Reference full text  

Mutant Phenotypes [TOP] [NEXT] Help
Phenotype page for PET9/YBL030C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT] Help
Interaction page for PET9/YBL030C

Homologs [TOP] [NEXT] Help
  • Comparison Resources
  • Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT] Help
    Protein Sequence Calculations
    from Predicted Full length Translation
    N-term MSSNAQV
    C-term LFGKKFK
    Length(aa) 318
    MW(Da) 34,426
    pI 10.61
    Amino Acid Composition (full length)
    GCG tools: PepPlot, Helical Wheel, PepStruct

    Transcript Translation Calculations
    Codon Bias 0.622  
    Codon Adaptation Index 0.538  
    Frequency of Optimal Codons 0.764  
    Hydropathicity of Protein 0.086  
    Aromaticity Score 0.113  

                              10        20        30        40        50
                               |         |         |         |         |
                      MSSNAQVKTPLPPAPAPKKESNFLIDFLMGGVSAAVAKTAASPIERVKLL
                      IQNQDEMLKQGTLDRKYAGILDCFKRTATQEGVISFWRGNTANVIRYFPT
                      QALNFAFKDKIKAMFGFKKEEGYAKWFAGNLASGGAAGALSLLFVYSLDY
                      ARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGI
                      VVYRGLYFGMYDSLKPLLLTGSLEGSFLASFLLGWVVTTGASTCSYPLDT
                      VRRRMMMTSGQAVKYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAG
                      VISMYDQLQMILFGKKFK*
    

    Protein Structures from PDB: proteins of known structure with sequence similarity to PET9/YBL030C, based on Smith-Waterman analysis. [TOP] [NEXT] Help
    PDB protein structure(s) homologous to PET9Homolog Source (per PDB)Protein Alignment: PET9 vs. HomologExternal Links
    P-Value%Identical%SimilarAlignment
    1okc ( Chain: A)
    Structure of mitochondrial adp/atp carrier in complex with carboxyatractyloside
  • PDB_Info
  • PDB_Structure
  • Bos taurus1.0e-655322View alignmentSCOP
    MMDB
    CATH
    2c3e ( Chain: A)
    The bovine mitochondrial adp-atp carrier
  • PDB_Info
  • PDB_Structure
  • Bos taurus1.0e-655322View alignmentSCOP
    MMDB
    CATH

    Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT] Help
  • Functional Analysis
  • You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

    Locus History (misc. notes) [TOP] [NEXT] Help
    Nomenclature History
    Standard NameReference
    PET9SGD (2007) Information without a citation in SGD
    SGD Papers Entry  
    Alias Name(s)Reference
    AAC2Lawson JE and Douglas MG (1988) Separate genes encode functionally equivalent ADP/ATP carrier proteins in Saccharomyces cerevisiae. Isolation and analysis of AAC2. J Biol Chem 263(29):14812-8
    SGD Papers Entry  Pubmed Entry  
    ANC2Brandolin G, et al. (1993) Biochemical characterisation of the isolated Anc2 adenine nucleotide carrier from Saccharomyces cerevisiae mitochondria. Biochem Biophys Res Commun 192(1):143-50
    SGD Papers Entry  Pubmed Entry  
    OP1Kovac L, et al. (1967) Biochemical genetics of oxidative phosphorylation. Science 158(808):1564-7
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    Mapping Notes
    DateNote
    1998-11-10Edition 15: The name ANC2, a non-standard name for pet9, has also been used to refer to CCT4, the cytoplasmic chaperonin subunit that was originally identified as an actin non-complement mutant (ANC).

    Cherry JM, et al. (1998) "Genetic and Physical Maps of Saccharomyces cerevisiae (Edition 15)". Pp. 414-420 in 1998 Yeast Genetics and Molecular Biology Meeting Program and Abstracts. Bethesda, MD: The Genetics Society of America
    SGD Papers Entry  

    1997-10-20Edition 14: pet9 is often referred to as op1

    Cherry JM, et al. (1997) Genetic and physical maps of Saccharomyces cerevisiae. Nature 387(6632 Suppl):67-73
    SGD Papers Entry  Pubmed Entry  Reference full text  

    Sequence Retrieval [TOP] [NEXT] Help
    Sequence Type Output Format
    Genomic DNA GCG | FASTA | NoHeader
    Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader
    DNA coding sequence
    (without introns, without flanking regions)
    GCG | FASTA | NoHeader
    Protein Translation of ORF GCG | FASTA | NoHeader
    6-Frame Translation(with Restriction Map) GCG
    Restriction Fragment Sizes GCG
  • Sequence Analysis Tools
  • Sequence from other databases
    Sequence IDSource
    YBL030CSGD Systematic Sequence
    852250NCBI: Gene ID
    NP_009523.1NCBI: RefSeq protein version ID
    NP_009523.1NCBI: RefSeq protein version ID
    6319441NCBI: NCBI protein GI

    Map and Displays [TOP] [NEXT] Help
    Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
    Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map  

    Localization [TOP] [NEXT] Help
  • Localization Resources
  • Community Annotation [TOP] [NEXT] Help
    No community annotation available.

    Literature Guide: papers categorized by topic. [TOP]   Help
    TopicsReferenceOther Genes Addressed
    145 curated references; 0 references not yet curated
    Techniques and Reagents
    Amutha B, et al. (2009) Chapter 14 Nucleotide-dependent iron-sulfur cluster biogenesis of endogenous and imported apoproteins in isolated intact mitochondria. Methods Enzymol 456:247-66
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ACO1 |GGC1 |NFS1 |YAH1
    Large-scale protein detection
    Techniques and Reagents
    Braun RJ, et al. (2009) 16-BAC/SDS-PAGE Analysis of Membrane Proteins of Yeast Mitochondria Purified by Free Flow Electrophoresis. Methods Mol Biol 528:83-107
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ACO1 |ALO1 |ATP1 |ATP2 |ATP7 |HSP60 |IDH2 |ILV5 |KGD2 |NDI1 |PDB1 |POR1 |RIP1 |SSC1
    Alias
    Cross-species Expression
    Genetic Interactions
    Mutants/Phenotypes
    Non-Fungal Related Genes/Proteins
    Strains/Constructs
    Feng J, et al. (2009) Tyrosine phosphorylation by Src within the cavity of the adenine nucleotide translocase 1 regulates ADP/ATP exchange in mitochondria. Am J Physiol Cell Physiol
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAC1 |AAC3
    Disease Gene Related
    Techniques and Reagents
    Fontanesi F, et al. (2009) Evaluation of the mitochondrial respiratory chain and oxidative phosphorylation system using yeast models of OXPHOS deficiencies. Curr Protoc Hum Genet Chapter 19:Unit19.5
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ATM1 |ATP6 |BCS1 |COX12 |EMI5 |ERV1 |LSC1 |MEF1 |MIP1 |MIR1 |ORT1 |PIC2 |SDH2 |SOD1 |MORE
    Cell Cycle Phase Involved
    Regulation of
    Goldberg AA, et al. (2009) Effect of calorie restriction on the metabolic history of chronologically aging yeast. Exp Gerontol 44(9):555-71
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ABF2 |ACO1 |ACT1 |ADH1 |ADH2 |ALD4 |ARE2 |ATH1 |ATP1 |ATP2 |AYR1 |CAF4 |CCP1 |CIT1 |MORE
    Techniques and Reagents
    Gubbens J, et al. (2009) Photocrosslinking and click chemistry enable the specific detection of proteins interacting with phospholipids at the membrane interface. Chem Biol 16(1):3-14
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ACO1 |ALD4 |ATP1 |ATP17 |ATP18 |ATP2 |ATP4 |ATP7 |CHC1 |COR1 |COX2 |COX4 |COX9 |COY1 |MORE
    Function/Process
    Mutants/Phenotypes
    Protein Physical Properties
    Protein Sequence Features
    Ohkura K, et al. (2009) Role of C-terminal region of yeast ADP/ATP carrier 2 protein: dynamics of flexible C-terminal arm. Anticancer Res 29(11):4897-900
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Function/Process
    Olsen LF, et al. (2009) Regulation of glycolytic oscillations by mitochondrial and plasma membrane H+-ATPases. Biophys J 96(9):3850-61
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ATP1 |ATP14 |ATP15 |ATP16 |ATP17 |ATP18 |ATP19 |ATP2 |ATP20 |ATP3 |ATP4 |ATP5 |ATP6 |ATP7 |MORE
    Regulation of
    Transcription
    Peiro-Chova L and Estruch F (2009) The yeast RNA polymerase II-associated factor Iwr1p is involved in the basal and regulated transcription of specific genes. J Biol Chem 284(42):28958-67
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ARG1 |ARG5,6 |ATP15 |ATP16 |ATP17 |ATP19 |ATP3 |ATP7 |BUR6 |COX13 |COX7 |GDH1 |HAP4 |HSP78 |MORE
    Strains/Constructs
    Techniques and Reagents
    Stuart RA (2009) Chapter 11 Supercomplex organization of the yeast respiratory chain complexes and the ADP/ATP carrier proteins. Methods Enzymol 456:191-208
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |COR1 |COX14 |COX2 |COX5A |QCR2 |SHY1 |TIM17 |TIM23
    Evolution
    Non-Fungal Related Genes/Proteins
    Szklarczyk R and Huynen MA (2009) Expansion of the human mitochondrial proteome by intra- and inter-compartmental protein duplication. Genome Biol 10(11):R135
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAC1 |AAC3 |AAT2 |ABC1 |ACN9 |ACO1 |ACP1 |ADK1 |ADK2 |AGC1 |AHP1 |ALD4 |ALD5 |ALD6 |MORE
    Reviews
    Traba J, et al. (2009) Transport of adenine nucleotides in the mitochondria of Saccharomyces cerevisiae: Interactions between the ADP/ATP carriers and the ATP-Mg/Pi carrier. Mitochondrion 9(2):79-85
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Protein-protein Interactions
    Alcock FH, et al. (2008) Conserved substrate binding by chaperones in the bacterial periplasm and the mitochondrial intermembrane space. Biochem J 409(2):377-87
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |POR1 |TIM10 |TIM9 |TOM40
    Alias
    Function/Process
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Azuma M, et al. (2008) Adenine nucleotide translocator transports haem precursors into mitochondria. PLoS ONE 3(8):e3070
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  
    |AAC1 |AAC3 |ATP3 |CTA1
    Mutants/Phenotypes
    Strains/Constructs
    Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE
    Alias
    Function/Process
    Genetic Interactions
    Mutants/Phenotypes
    Protein-protein Interactions
    Regulation of
    Strains/Constructs
    Claypool SM, et al. (2008) Cardiolipin defines the interactome of the major ADP/ATP carrier protein of the mitochondrial inner membrane. J Cell Biol 182(5):937-50
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAC1 |ADH3 |COB |COR1 |COX12 |COX13 |COX2 |COX4 |COX5A |COX6 |CRD1 |CYC1 |CYT1 |DIC1 |MORE
    Protein-protein Interactions
    Strains/Constructs
    Claypool SM, et al. (2008) The cardiolipin transacylase, tafazzin, associates with two distinct respiratory components providing insight into Barth syndrome. Mol Biol Cell 19(12):5143-55
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ATP1 |ATP2 |CRD1 |TAZ1
    Function/Process
    Mutants/Phenotypes
    Protein Sequence Features
    Strains/Constructs
    Substrates/Ligands/Cofactors
    Clemencon B, et al. (2008) Structure-Function Relationships of the C-Terminal End of the Saccharomyces cerevisiae ADP/ATP Carrier Isoform 2. J Biol Chem 283(17):11218-11225
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Alias
    Mutants/Phenotypes
    Non-Fungal Related Genes/Proteins
    Protein Physical Properties
    Protein Processing/Modification/Regulation
    Protein/Nucleic Acid Structure
    Strains/Constructs
    Substrates/Ligands/Cofactors
    David C, et al. (2008) Two residues of a conserved aromatic ladder of the mitochondrial ADP/ATP carrier are crucial to nucleotide transport. Biochemistry 47(50):13223-31
    SGD Papers Entry  Pubmed Entry  

    Protein-protein Interactions
    Strains/Constructs
    Dienhart MK and Stuart RA (2008) The Yeast Aac2 Protein Exists in Physical Association with the Cytochrome bc1-COX Supercomplex and the TIM23 Machinery. Mol Biol Cell 19(9):3934-43
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |COR1 |COX2 |PAM16 |QCR2 |QCR6 |QCR7 |TIM17 |TIM23 |TIM44 |TIM50
    Genetic Interactions
    Mutants/Phenotypes
    Hlavata L, et al. (2008) Elevated Ras/protein kinase A activity in Saccharomyces cerevisiae reduces proliferation rate and lifespan by two different reactive oxygen species-dependent routes. Aging Cell 7(2):148-57
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  
    |BCY1 |RAS2 |SOD1
    Alias
    Cross-species Expression
    Mutants/Phenotypes
    Non-Fungal Related Genes/Proteins
    Protein Sequence Features
    Strains/Constructs
    Iwahashi A, et al. (2008) Functionally important conserved length of C-terminal regions of yeast and bovine ADP/ATP carriers, identified by deletion mutants studies, and water accessibility of the amino acids at the C-terminal region of the yeast carrier. Mitochondrion 8(2):196-204
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Non-Fungal Related Genes/Proteins
    Protein Sequence Features
    Strains/Constructs
    Kihira Y (2008) Functional Interactions between Transmembrane Regions and Their C-Terminal Adjoining Loop in Mitochondrial ADP/ATP Carrier. Biol Pharm Bull 31(11):2001-6
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Alias
    Function/Process
    Genetic Interactions
    Mutants/Phenotypes
    Protein Sequence Features
    Strains/Constructs
    Kucejova B, et al. (2008) Pleiotropic effects of the yeast Sal1 and Aac2 carriers on mitochondrial function via an activity distinct from adenine nucleotide transport. Mol Genet Genomics 280(1):25-39
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAC1 |GGC1 |MTG1 |SAL1 |SHY1
    Alias
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Mroczek S and Kufel J (2008) Apoptotic signals induce specific degradation of ribosomal RNA in yeast. Nucleic Acids Res 36(9):2874-88
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAC1 |AAC3 |AHP1 |AIF1 |DOT5 |GPX1 |GPX2 |GRX1 |GRX2 |GSH1 |HTB1 |HTB2 |HYR1 |MCA1 |MORE
    Genetic Interactions
    Mutants/Phenotypes
    Protein Sequence Features
    Strains/Constructs
    Smith CP and Thorsness PE (2008) The Molecular Basis for Relative Physiological Functionality of the ADP/ATP Carrier Isoforms in Saccharomyces cerevisiae. Genetics 179(3):1285-99
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAC1 |AAC3 |SAL1
    Reviews
    Stuart RA (2008) Supercomplex organization of the oxidative phosphorylation enzymes in yeast mitochondria. J Bioenerg Biomembr 40(5):411-7
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ATP1 |ATP14 |ATP15 |ATP16 |ATP17 |ATP18 |ATP19 |ATP2 |ATP20 |ATP3 |ATP4 |ATP5 |ATP6 |ATP7 |MORE
    Alias
    Function/Process
    Genetic Interactions
    Strains/Constructs
    Substrates/Ligands/Cofactors
    Traba J, et al. (2008) Yeast mitochondria import ATP through the calcium-dependent ATP-Mg/Pi carrier Sal1p, and are ATP consumers during aerobic growth in glucose. Mol Microbiol 69(3):570-85
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAC1 |MRS2 |SAL1
    Disease Gene Related
    Function/Process
    Mutants/Phenotypes
    Non-Fungal Related Genes/Proteins
    Protein Sequence Features
    Strains/Constructs
    Wang X, et al. (2008) Dominant membrane uncoupling by mutant adenine nucleotide translocase in mitochondrial diseases. Hum Mol Genet 17(24):4036-44
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Alias
    Disease Gene Related
    Function/Process
    Genetic Interactions
    Mutants/Phenotypes
    Non-Fungal Related Genes/Proteins
    Strains/Constructs
    Wang X, et al. (2008) Reduced cytosolic protein synthesis suppresses mitochondrial degeneration. Nat Cell Biol 10(9):1090-7
    SGD Papers Entry  Pubmed Entry  
    |ATP1 |COX2 |COX4 |CYT1 |FOB1 |GPR1 |HSP60 |PHB1 |PHB2 |REI1 |RPD3 |RPL31A |RPL6B |SCH9 |MORE
    Alias
    Cellular Location
    Function/Process
    Mutants/Phenotypes
    Protein Processing/Modification/Regulation
    Protein Sequence Features
    Protein/Nucleic Acid Structure
    Strains/Constructs
    Bamber L, et al. (2007) The yeast mitochondrial ADP/ATP carrier functions as a monomer in mitochondrial membranes. Proc Natl Acad Sci U S A 104(26):10830-4
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  Reference LINKOUT  

    Function/Process
    Strains/Constructs
    Substrates/Ligands/Cofactors
    Techniques and Reagents
    Bamber L, et al. (2007) Yeast Mitochondrial ADP/ATP Carriers Are Monomeric in Detergents as Demonstrated by Differential Affinity Purification. J Mol Biol 371(2):388-95
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Alias
    Genetic Interactions
    Protein-protein Interactions
    Strains/Constructs
    Buttner S, et al. (2007) Endonuclease g regulates budding yeast life and death. Mol Cell 25(2):233-46
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAC1 |AAC3 |AIF1 |HHF1 |HHF2 |HTB1 |HTB2 |KAP123 |MCA1 |NUC1 |POR1
    Protein-protein Interactions
    Davis AJ, et al. (2007) The Tim9p/10p and Tim8p/13p complexes bind to specific sites on Tim23p during mitochondrial protein import. Mol Biol Cell 18(2):475-86
    SGD Papers Entry  Pubmed Entry  
    |TIM10 |TIM13 |TIM23 |TIM8 |TIM9
    Alias
    Non-Fungal Related Genes/Proteins
    Protein Sequence Features
    Protein/Nucleic Acid Structure
    Strains/Constructs
    Substrates/Ligands/Cofactors
    Kihira Y, et al. (2007) Difference between Yeast and Bovine Mitochondrial ADP/ATP Carriers in Terms of Conformational Properties of the First Matrix Loop as Deduced by Use of Copper-o-phenanthroline. Biol Pharm Bull 30(5):885-90
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAC1
    Protein-protein Interactions
    Mick DU, et al. (2007) Shy1 couples Cox1 translational regulation to cytochrome c oxidase assembly. EMBO J 26(20):4347-58
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |COA1 |COR1 |COX1 |COX14 |COX2 |COX3 |COX4 |COX5A |CYT1 |MSS51 |QCR2 |QCR6 |RIP1 |SHY1
    Function/Process
    Mutants/Phenotypes
    Strains/Constructs
    Pereira C, et al. (2007) ADP/ATP carrier is required for mitochondrial outer membrane permeabilization and cytochrome c release in yeast apoptosis. Mol Microbiol 66(3):571-82
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  SGD Curated Comments & Errata
    |AAC1 |AAC3 |ATP2 |CPR3 |MCA1 |POR1
    Protein Processing/Modification/Regulation
    Protein Sequence Features
    Reinders J, et al. (2007) Profiling phosphoproteins of yeast mitochondria reveals a role of phosphorylation in assembly of the ATP synthase. Mol Cell Proteomics 6(11):1896-906
    SGD Papers Entry  Pubmed Entry  Reference full text  
    |AAC1 |ACH1 |ACO1 |ADY2 |ALD4 |ATO2 |ATO3 |ATP1 |ATP15 |ATP16 |ATP2 |ATP20 |ATP4 |ATP5 |MORE
    Function/Process
    Strains/Constructs
    Techniques and Reagents
    Rey M, et al. (2007) The Saccharomyces cerevisiae ADP/ATP carrier-iso 1 cytochrome c fusion protein: One-step purification and functional analysis in vitro. Biochimie 89(9):1070-1079
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |CYC1
    Regulation of
    de Groot MJ, et al. (2007) Quantitative proteomics and transcriptomics of anaerobic and aerobic yeast cultures reveals post-transcriptional regulation of key cellular processes. Microbiology 153(Pt 11):3864-3878
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  yfgdb  
    |ACO1 |ACO2 |ACS1 |ACS2 |ADE13 |ADE17 |ADE2 |ADE3 |ADE4 |ADE5,7 |ADE6 |ADH1 |ADH2 |ADH5 |MORE
    Cellular Location
    Protein-protein Interactions
    Techniques and Reagents
    Brandina I, et al. (2006) Enolase takes part in a macromolecular complex associated to mitochondria in yeast. Biochim Biophys Acta 1757(9-10):1217-1228
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ACO1 |ATP1 |ATP2 |CDC19 |CIT1 |CIT3 |COX2 |ENO1 |ENO2 |FBA1 |GPM1 |HXK1 |HXK2 |MDH1 |MORE
    Evolution
    Fungal Related Genes/Proteins
    De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81
    SGD Papers Entry  Pubmed Entry  Reference full text  
    |AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
    Cross-species Expression
    Fungal Related Genes/Proteins
    Fontanesi F, et al. (2006) Heterologous complementation of the Klaac null mutation of Kluyveromyces lactis by the Saccharomyces cerevisiae AAC3 gene encoding the ADP/ATP carrier. FEMS Yeast Res 6(3):414-20
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAC1 |AAC3
    Function/Process
    Mutants/Phenotypes
    Protein Sequence Features
    Protein/Nucleic Acid Structure
    Strains/Constructs
    Iwahashi A, et al. (2006) The structure of the second cytosolic loop of the yeast mitochondrial ADP/ATP carrier AAC2 is dependent on the conformational state. Mitochondrion 6(5):245-51
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Function/Process
    Mutants/Phenotypes
    Protein Sequence Features
    Kihira Y, et al. (2006) Roles of adjoining Asp and Cys residues of first matrix-facing loop in transport activity of yeast and bovine mitochondrial ADP/ATP carriers. J Biochem 139(3):575-82
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  

    Alias
    Cross-species Expression
    Disease Gene Related
    Non-Fungal Related Genes/Proteins
    Strains/Constructs
    Lodi T, et al. (2006) Mutation D104G in ANT1 gene: complementation study in Saccharomyces cerevisiae as a model system. Biochem Biophys Res Commun 341(3):810-5
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  Reference LINKOUT  
    |AAC1
    Regulation of
    Transcription
    Mojzita D and Hohmann S (2006) Pdc2 coordinates expression of the THI regulon in the yeast Saccharomyces cerevisiae. Mol Genet Genomics 276(2):147-61
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Web Supplement  
    |ARO10 |FSH1 |INO1 |IPP1 |ITR1 |KGD2 |MDH1 |NRT1 |OLE1 |PDC1 |PDC2 |PDC5 |PET18 |PHO3 |MORE
    Reviews
    Palmieri F, et al. (2006) Identification of mitochondrial carriers in Saccharomyces cerevisiae by transport assay of reconstituted recombinant proteins. Biochim Biophys Acta 1757(9-10):1249-62
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAC1 |AAC3 |AGC1 |ANT1 |CAT2 |CRC1 |CTP1 |DIC1 |FLX1 |GGC1 |LEU5 |MIR1 |MRS3 |MRS4 |MORE
    Cellular Location
    Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Web Supplement  yfgdb  
    |AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACN9 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |MORE
    Fungal Related Genes/Proteins
    Mutants/Phenotypes
    Snoek IS and Steensma HY (2006) Why does Kluyveromyces lactis not grow under anaerobic conditions? Comparison of essential anaerobic genes of Saccharomyces cerevisiae with the Kluyveromyces lactis genome. FEMS Yeast Res 6(3):393-403
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ACP1 |ARB1 |ARG82 |ARH1 |ARV1 |ATM1 |BTS1 |BUR6 |CAB2 |CAX4 |CDC40 |CNM67 |CTF4 |DBP7 |MORE
    Protein Processing/Modification/Regulation
    Protein-protein Interactions
    Techniques and Reagents
    Tagwerker C, et al. (2006) A tandem affinity tag for two-step purification under fully denaturing conditions: application in ubiquitin profiling and protein complex identification combined with in vivocross-linking. Mol Cell Proteomics 5(4):737-48
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  yfgdb  
    |AAC1 |AAC3 |ACB1 |ACC1 |ACS2 |ADE3 |ADE5,7 |ADE6 |ADH4 |ADO1 |AGP1 |AHA1 |AHP1 |ALA1 |MORE
    Reviews
    Arco AD and Satrustegui J (2005) New mitochondrial carriers: an overview. Cell Mol Life Sci 62(19-20):2204-27
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAC1 |AGC1 |ANT1 |CRC1 |CTP1 |DIC1 |FLX1 |GGC1 |LEU5 |MIR1 |MRS3 |MRS4 |MTM1 |OAC1 |MORE
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Cavero S, et al. (2005) The calcium-dependent ATP-Mg/Pi mitochondrial carrier is a target of glucose-induced calcium signalling in Saccharomyces cerevisiae. Biochem J 392(Pt 3):537-44
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAC1 |AAC3 |SAL1
    Cellular Location
    Function/Process
    Mutants/Phenotypes
    Protein Sequence Features
    Protein/Nucleic Acid Structure
    Strains/Constructs
    Dahout-Gonzalez C, et al. (2005) Conformation-dependent swinging of the matrix loop m2 of the mitochondrial Saccharomyces cerevisiae ADP/ATP carrier. Biochemistry 44(49):16310-20
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Function/Process
    Strains/Constructs
    Dassa EP, et al. (2005) Functional characterization and purification of a Saccharomyces cerevisiae ADP/ATP carrier-iso 1 cytochrome c fusion protein. Protein Expr Purif 40(2):358-69
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  
    |CYC1
    Function/Process
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Dzugasova V and Subik J (2005) Synthetic lethal interaction between the pel1 and op1 mutations in Saccharomyces cerevisiae. Folia Microbiol (Praha) 50(4):293-9
    SGD Papers Entry  Pubmed Entry  
    |CRD1 |PGS1
    Function/Process
    Mutants/Phenotypes
    Protein Physical Properties
    Protein Sequence Features
    Protein/Nucleic Acid Structure
    Strains/Constructs
    Kihira Y, et al. (2005) Cysteine labeling studies detect conformational changes in region 106-132 of the mitochondrial ADP/ATP carrier of Saccharomyces cerevisiae. Biochemistry 44(1):184-92
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Cross-species Expression
    Function/Process
    Fungal Related Genes/Proteins
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Mentel M, et al. (2005) Triplicate genes for mitochondrial ADP/ATP carriers in the aerobic yeast Yarrowia lipolytica are regulated differentially in the absence of oxygen. Mol Genet Genomics 273(1):84-91
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Cross-species Expression
    Mutants/Phenotypes
    Protein Sequence Features
    Monne M, et al. (2005) Functional expression of eukaryotic membrane proteins in Lactococcus lactis. Protein Sci 14(12):3048-56
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAC1 |AAC3 |DIC1 |GGC1 |MIR1 |OAC1 |ODC1 |ODC2 |PET8
    Disease Gene Related
    Function/Process
    Mutants/Phenotypes
    Strains/Constructs
    Palmieri L, et al. (2005) Complete loss-of-function of the heart/muscle-specific adenine nucleotide translocator is associated with mitochondrial myopathy and cardiomyopathy. Hum Mol Genet 14(20):3079-88
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  

    Function/Process
    Strains/Constructs
    Substrates/Ligands/Cofactors
    Postis V, et al. (2005) Subunits of the yeast mitochondrial ADP/ATP carrier: cooperation within the dimer. Biochemistry 44(45):14732-40
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |MIR1
    RNA Levels and Processing
    Regulation of
    Transcription
    Puig S, et al. (2005) Coordinated remodeling of cellular metabolism during iron deficiency through targeted mRNA degradation. Cell 120(1):99-110
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  Web Supplement  yfgdb  
    |ACO1 |AFT1 |AFT2 |CCC1 |CCP1 |CIR2 |CIT1 |CIT3 |COQ6 |COR1 |COX4 |COX6 |COX8 |COX9 |MORE
    Cellular Location
    Protein Sequence Features
    Vergnolle MA, et al. (2005) A cryptic matrix targeting signal of the yeast ADP/ATP carrier normally inserted by the TIM22 complex is recognized by the TIM23 machinery. Biochem J 385(Pt 1):173-80
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |TIM10 |TIM12 |TIM22 |TIM23
    Function/Process
    Fungal Related Genes/Proteins
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Chen XJ (2004) Sal1p, a calcium-dependent carrier protein that suppresses an essential cellular function associated With the Aac2 isoform of ADP/ATP translocase in Saccharomyces cerevisiae. Genetics 167(2):607-17
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAC1 |AAC3 |SAL1
    Alias
    Disease Gene Related
    Mutants/Phenotypes
    Non-Fungal Related Genes/Proteins
    Strains/Constructs
    Fontanesi F, et al. (2004) Mutations in AAC2, equivalent to human adPEO-associated ANT1 mutations, lead to defective oxidative phosphorylation in Saccharomyces cerevisiae and affect mitochondrial DNA stability. Hum Mol Genet 13(9):923-34
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Reviews
    Reichert AS and Neupert W (2004) Mitochondriomics or what makes us breathe. Trends Genet 20(11):555-62
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ATM1 |FZO1 |HSP60 |ISC1 |MGM1 |OXA1 |POR1 |SSC1 |TIM22 |TIM23 |TIM8 |YFH1
    Fungal Related Genes/Proteins
    Zhang Z and Kishino H (2004) Genomic background predicts the fate of duplicated genes: evidence from the yeast genome. Genetics 166(4):1995-9
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  Reference LINKOUT  
    |AAC1 |ALD4 |ALD5 |BDH1 |BDH2 |CAM1 |CCT4 |CCT6 |CDC19 |CLB3 |CLB4 |CYS3 |DCS1 |DCS2 |MORE
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Dunn CD and Jensen RE (2003) Suppression of a defect in mitochondrial protein import identifies cytosolic proteins required for viability of yeast cells lacking mitochondrial DNA. Genetics 165(1):35-45
    SGD Papers Entry  Pubmed Entry  
    |ATP2 |CCT6 |COQ4 |CYT1 |ICY1 |PBP1 |SSB1 |TIM10 |TIM18 |TIM22 |TIM54 |TIP41 |TOM70 |YME1
    Cellular Location
    Mutants/Phenotypes
    Protein Sequence Features
    Protein-protein Interactions
    Strains/Constructs
    Dyall SD, et al. (2003) The dynamic dimerization of the yeast ADP/ATP carrier in the inner mitochondrial membrane is affected by conserved cysteine residues. J Biol Chem 278(29):26757-64
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAC1 |TIM10 |TIM22
    Strains/Constructs
    Techniques and Reagents
    Kunji ER, et al. (2003) Lactococcus lactis as host for overproduction of functional membrane proteins. Biochim Biophys Acta 1610(1):97-108
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  

    Protein Physical Properties
    Protein/Nucleic Acid Structure
    Lorenz-Fonfria VA, et al. (2003) Structural and functional implications of the instability of the ADP/ATP transporter purified from mitochondria as revealed by FTIR spectroscopy. Biophys J 85(1):255-66
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Cellular Location
    Protein Sequence Features
    Protein/Nucleic Acid Structure
    Techniques and Reagents
    Panneels V, et al. (2003) Choline head groups stabilize the matrix loop regions of the ATP/ADP carrier ScAAC2. Biochem Biophys Res Commun 300(1):65-74
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  Reference LINKOUT  

    Cellular Location
    Sickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12
    SGD Papers Entry  Pubmed Entry  Web Supplement  yfgdb  
    |AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |ADK2 |MORE
    Function/Process
    Mutants/Phenotypes
    Protein Sequence Features
    Protein/Nucleic Acid Structure
    Strains/Constructs
    Zeman I, et al. (2003) Four mutations in transmembrane domains of the mitochondrial ADP/ATP carrier increase resistance to bongkrekic acid. J Bioenerg Biomembr 35(3):243-56
    SGD Papers Entry  Pubmed Entry  

    Regulation of
    Transcription
    Zhang W, et al. (2003) Microarray analyses of the metabolic responses of Saccharomyces cerevisiae to organic solvent dimethyl sulfoxide. J Ind Microbiol Biotechnol 30(1):57-69
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  
    |AAH1 |ABP140 |ACS2 |ADE1 |ADE12 |ADE17 |ADE4 |ADE8 |ADH2 |ADH4 |ADH5 |ADK1 |ADO1 |ALD3 |MORE
    Function/Process
    Mutants/Phenotypes
    Non-Fungal Related Genes/Proteins
    Strains/Constructs
    Chen XJ (2002) Induction of an unregulated channel by mutations in adenine nucleotide translocase suggests an explanation for human ophthalmoplegia. Hum Mol Genet 11(16):1835-43
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Cellular Location
    Jensen RE and Dunn CD (2002) Protein import into and across the mitochondrial inner membrane: role of the TIM23 and TIM22 translocons. Biochim Biophys Acta 1592(1):25-34
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  
    |TIM22 |TIM23 |TIM54
    RNA Levels and Processing
    Regulation of
    Palkova Z, et al. (2002) Ammonia pulses and metabolic oscillations guide yeast colony development. Mol Biol Cell 13(11):3901-14
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Web Supplement  yfgdb  
    |AAC3 |AAT1 |ACO1 |ACS1 |ADY2 |ALD4 |ALD5 |ATO2 |ATO3 |ATP15 |ATP2 |CAT2 |CHA1 |CIT3 |MORE
    Cellular Location
    Truscott KN, et al. (2002) Mitochondrial import of the ADP/ATP carrier: the essential TIM complex of the intermembrane space is required for precursor release from the TOM complex. Mol Cell Biol 22(22):7780-9
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |MGE1 |TIM10 |TIM12 |TIM13 |TIM17 |TIM18 |TIM22 |TIM23 |TIM44 |TIM54 |TIM8 |TIM9 |TOM20 |TOM22 |MORE
    Alias
    Cellular Location
    Mutants/Phenotypes
    Protein Sequence Features
    Strains/Constructs
    Substrates/Ligands/Cofactors
    Techniques and Reagents
    Hatanaka T, et al. (2001) Characterization of loops of the yeast mitochondrial ADP/ATP carrier facing the cytosol by site-directed mutagenesis. Biochem Biophys Res Commun 286(5):936-42
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Alias
    DNA/RNA Sequence Features
    Function/Process
    Non-Fungal Related Genes/Proteins
    Protein Sequence Features
    Strains/Constructs
    Hatanaka T, et al. (2001) Significant effect of the N-terminal region of the mitochondrial ADP/ATP carrier on its efficient expression in yeast mitochondria. J Biol Chem 276(31):28881-8
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Non-Fungal Related Genes/Proteins
    Heimpel S, et al. (2001) Expression of the mitochondrial ADP/ATP carrier in Escherichia coli. Renaturation, reconstitution, and the effect of mutations on 10 positive residues. J Biol Chem 276(15):11499-506
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAC1
    Alias
    Cellular Location
    DNA/RNA Sequence Features
    Function/Process
    Mutants/Phenotypes
    Protein Physical Properties
    Substrates/Ligands/Cofactors
    Huang SG, et al. (2001) Chimers of two fused ADP/ATP carrier monomers indicate a single channel for ADP/ATP transport. Arch Biochem Biophys 394(1):67-75
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Cellular Location
    Protein-protein Interactions
    Regulation of
    Strains/Constructs
    Wiedemann N, et al. (2001) The three modules of ADP/ATP carrier cooperate in receptor recruitment and translocation into mitochondria. EMBO J 20(5):951-60
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAC1 |AAC3 |TOM70
    Reviews
    Chen XJ and Clark-Walker GD (2000) The petite mutation in yeasts: 50 years on. Int Rev Cytol 194:197-238
    SGD Papers Entry  Pubmed Entry  
    |PGS1 |YME1
    Function/Process
    Protein Sequence Features
    Strains/Constructs
    Substrates/Ligands/Cofactors
    Techniques and Reagents
    Dianoux AC, et al. (2000) Two distinct regions of the yeast mitochondrial ADP/ATP carrier are photolabeled by a new ADP analogue: 2-azido-3'-O-naphthoyl-[beta-32P]ADP. Identification of the binding segments by mass spectrometry. Biochemistry 39(37):11477-87
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Function/Process
    Non-Fungal Related Genes/Proteins
    Other Features
    Dyall SD, et al. (2000) Presence of a member of the mitochondrial carrier family in hydrogenosomes: conservation of membrane-targeting pathways between hydrogenosomes and mitochondria. Mol Cell Biol 20(7):2488-97
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAC1 |AAC3 |TIM10 |TIM9
    Alias
    Function/Process
    Substrates/Ligands/Cofactors
    Techniques and Reagents
    Fiore C, et al. (2000) Purification of histidine-tagged mitochondrial ADP/ATP carrier: influence of the conformational states of the C-terminal region. Protein Expr Purif 19(1):57-65
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAC1 |AAC3
    Mutants/Phenotypes
    Other Features
    Strains/Constructs
    Harris MH, et al. (2000) Role of oxidative phosphorylation in Bax toxicity. Mol Cell Biol 20(10):3590-6
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |ATP4 |COX4 |COX7 |CYC3 |NDI1 |POR1 |QCR7 |SDH3
    Function/Process
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Kissova I, et al. (2000) The cytotoxic action of Bax on yeast cells does not require mitochondrial ADP/ATP carrier but may be related to its import to the mitochondria. FEBS Lett 471(1):113-8
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAC1 |AAC3
    Function/Process
    Mutants/Phenotypes
    Substrates/Ligands/Cofactors
    Techniques and Reagents
    Lunde CS and Kubo I (2000) Effect of polygodial on the mitochondrial ATPase of Saccharomyces cerevisiae. Antimicrob Agents Chemother 44(7):1943-53
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |PMA1
    Function/Process
    Protein Sequence Features
    Protein-protein Interactions
    Substrates/Ligands/Cofactors
    Techniques and Reagents
    Trezeguet V, et al. (2000) A covalent tandem dimer of the mitochondrial ADP/ATP carrier is functional in vivo. Biochim Biophys Acta 1457(1-2):81-93
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Function/Process
    Other Features
    Chen XJ and Clark-Walker GD (1999) Alpha and beta subunits of F1-ATPase are required for survival of petite mutants in Saccharomyces cerevisiae. Mol Gen Genet 262(4-5):898-908
    SGD Papers Entry  Pubmed Entry  
    |ATP1 |ATP15 |ATP16 |ATP2 |PGS1 |YME1
    RNA Levels and Processing
    Regulation of
    Ferea TL, et al. (1999) Systematic changes in gene expression patterns following adaptive evolution in yeast. Proc Natl Acad Sci U S A 96(17):9721-6
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Web Supplement  yfgdb  
    |ACO1 |ACS1 |ADE5,7 |ADH1 |ADH2 |ALD4 |ALD6 |ATP1 |ATP14 |ATP16 |ATP17 |ATP3 |ATP4 |ATP5 |MORE
    Cellular Location
    Function/Process
    Protein-protein Interactions
    Hatanaka T, et al. (1999) Functional expression of the tandem-repeated homodimer of the mitochondrial ADP/ATP carrier in Saccharomyces cerevisiae. Biochem Biophys Res Commun 262(3):726-30
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Fungal Related Genes/Proteins
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Nebohacova M, et al. (1999) Isolation and expression of the gene encoding mitochondrial ADP/ATP carrier (AAC) from the pathogenic yeast Candida parapsilosis. Yeast 15(12):1237-42
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAC3
    Protein Processing/Modification/Regulation
    Protein-protein Interactions
    Ryan MT, et al. (1999) Functional staging of ADP/ATP carrier translocation across the outer mitochondrial membrane. J Biol Chem 274(29):20619-27
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAC1 |AAC3 |SAM37 |TIM10 |TOM20 |TOM40 |TOM70
    Alias
    Fungal Related Genes/Proteins
    Viola AM, et al. (1999) A Klaac null mutant of Kluyveromyces lactis is complemented by a single copy of the Saccharomyces cerevisiae AAC1 gene. Curr Genet 36(1-2):29-36
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAC1 |HAP2
    Cellular Location
    Protein Processing/Modification/Regulation
    Kubrich M, et al. (1998) The import route of ADP/ATP carrier into mitochondria separates from the general import pathway of cleavable preproteins at the trans side of the outer membrane. J Biol Chem 273(26):16374-81
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |TOM22 |TOM7 |TOM70
    Alias
    Mutants/Phenotypes
    Protein Sequence Features
    Protein/Nucleic Acid Structure
    Strains/Constructs
    Nelson DR, et al. (1998) Highly conserved charge-pair networks in the mitochondrial carrier family. J Mol Biol 277(2):285-308
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Function/Process
    Fungal Related Genes/Proteins
    Mutants/Phenotypes
    Strains/Constructs
    Joseph-Liauzun E, et al. (1997) The Mr 18,000 subunit of the peripheral-type benzodiazepine receptor exhibits both benzodiazepine and isoquinoline carboxamide binding sites in the absence of the voltage-dependent anion channel or of the adenine nucleotide carrier. J Biol Chem 272(44):28102-6
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAC1 |AAC3 |POR1
    Alias
    Function/Process
    Mutants/Phenotypes
    Protein Sequence Features
    Protein/Nucleic Acid Structure
    Strains/Constructs
    Substrates/Ligands/Cofactors
    Techniques and Reagents
    Muller V, et al. (1997) Mutagenesis of some positive and negative residues occurring in repeat triad residues in the ADP/ATP carrier from yeast. Biochemistry 36(50):16008-18
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Alias
    Mutants/Phenotypes
    Strains/Constructs
    Polcic P, et al. (1997) Fatty acids induced uncoupling of Saccharomyces cerevisiae mitochondria requires an intact ADP/ATP carrier. FEBS Lett 412(1):207-10
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Alias
    Mutants/Phenotypes
    Strains/Constructs
    Roucou X, et al. (1997) Conditions allowing different states of ATP- and GDP-induced permeability in mitochondria from different strains of Saccharomyces cerevisiae. Biochim Biophys Acta 1324(1):120-32
    SGD Papers Entry  Pubmed Entry  

    Cellular Location
    Function/Process
    Fungal Related Genes/Proteins
    Protein Physical Properties
    Protein Sequence Features
    Protein/Nucleic Acid Structure
    el Moualij B, et al. (1997) Phylogenetic classification of the mitochondrial carrier family of Saccharomyces cerevisiae. Yeast 13(6):573-81
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAC1 |AAC3 |AGC1 |ANT1 |CRC1 |CTP1 |DIC1 |FLX1 |GGC1 |LEU5 |MIR1 |MRS3 |MRS4 |MTM1 |MORE
    Alias
    Cross-species Expression
    Fungal Related Genes/Proteins
    Mutants/Phenotypes
    Non-Fungal Related Genes/Proteins
    Strains/Constructs
    Couzin N, et al. (1996) Cloning of the gene encoding the mitochondrial adenine nucleotide carrier of Schizosaccharomyces pombe by functional complementation in Saccharomyces cerevisiae. Gene 171(1):113-7
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |AAC1 |AAC3
    Alias
    Cellular Location
    Function/Process
    Fungal Related Genes/Proteins
    Gavurnikova G, et al. (1996) Transcription of the AAC1 gene encoding an isoform of mitochondrial ADP/ATP carrier in Saccharomyces cerevisiae is regulated by oxygen in a heme-independent manner. Eur J Biochem 239(3):759-63
    SGD Papers Entry  Pubmed Entry  
    |AAC1 |AAC3
    Alias
    Mutants/Phenotypes
    Protein Sequence Features
    Strains/Constructs
    Substrates/Ligands/Cofactors
    Le Saux A, et al. (1996) Conformational changes of the yeast mitochondrial adenosine diphosphate/adenosine triphosphate carrier studied through its intrinsic fluorescence. 1. Tryptophanyl residues of the carrier can be mutated without impairing protein activity. Biochemistry 35(50):16116-24
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Alias
    Function/Process
    Fungal Related Genes/Proteins
    Mutants/Phenotypes
    Non-Fungal Related Genes/Proteins
    Protein/Nucleic Acid Structure
    Strains/Constructs
    Techniques and Reagents
    Muller V, et al. (1996) Probing the role of positive residues in the ADP/ATP carrier from yeast. The effect of six arginine mutations of oxidative phosphorylation and AAC expression. Biochemistry 35(50):16132-43
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Alias
    Regulation of
    Nebohacova M, et al. (1996) Oxygen- and carbon source-dependent transactivation effect of ABF1 on the expression of the AAC2 gene encoding mitochondrial ADP/ATP carrier. Folia Microbiol (Praha) 41(1):115-6
    SGD Papers Entry  Pubmed Entry  
    |ABF1 |CHA4
    Alias
    Protein Physical Properties
    Protein Sequence Features
    Protein/Nucleic Acid Structure
    Substrates/Ligands/Cofactors
    Roux P, et al. (1996) Conformational changes of the yeast mitochondrial adenosine diphosphate/adenosine triphosphate carrier studied through its intrinsic fluorescence. 2. Assignment of tryptophanyl residues of the carrier to the responses to specific ligands. Biochemistry 35(50):16125-31
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Mapping
    Song JM, et al. (1996) Organization and characterization of the two yeast ribosomal protein YL19 genes. Curr Genet 30(4):273-8
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |RPL19A |RPL19B |YBL028C |YBL029W
    Alias
    DNA/RNA Sequence Features
    Fungal Related Genes/Proteins
    Mutants/Phenotypes
    Protein Processing/Modification/Regulation
    RNA Levels and Processing
    Regulation of
    Strains/Constructs
    Betina S, et al. (1995) Expression of the AAC2 gene encoding the major mitochondrial ADP/ATP carrier in Saccharomyces cerevisiae is controlled at the transcriptional level by oxygen, heme and HAP2 factor. Eur J Biochem 229(3):651-7
    SGD Papers Entry  Pubmed Entry  
    |AAC1 |AAC3 |ABF1 |HAP2 |HAP3
    Cellular Location
    Protein Processing/Modification/Regulation
    Haucke V, et al. (1995) The yeast mitochondrial protein import receptor Mas20p binds precursor proteins through electrostatic interaction with the positively charged presequence. J Biol Chem 270(10):5565-70
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  
    |HSP10 |HSP60 |RIP1 |SAM37 |TOM20 |TOM22 |TOM70
    Alias
    Cross-species Expression
    Fungal Related Genes/Proteins
    Mutants/Phenotypes
    Non-Fungal Related Genes/Proteins
    Strains/Constructs
    Viola AM, et al. (1995) A kluyveromyces lactis gene homologue to AAC2 complements the Saccaromyces cerevisiae op1 mutation. Curr Genet 27(3):229-33
    SGD Papers Entry  Pubmed Entry  
    |AAC1
    Alias
    Function/Process
    Mutants/Phenotypes
    Protein Physical Properties
    Protein/Nucleic Acid Structure
    Strains/Constructs
    Techniques and Reagents
    Hoffmann B, et al. (1994) The reconstituted ADP/ATP carrier activity has an absolute requirement for cardiolipin as shown in cysteine mutants. J Biol Chem 269(3):1940-4
    SGD Papers Entry  Pubmed Entry  
    |AAC1
    Mutants/Phenotypes
    Strains/Constructs
    Kule C, et al. (1994) Doxorubicin, daunorubicin, and mitoxantrone cytotoxicity in yeast. Mol Pharmacol 46(6):1234-40
    SGD Papers Entry  Pubmed Entry  

    Alias
    Mapping
    Van Dyck L, et al. (1994) Analysis of a 17.4 kb DNA segment of yeast chromosome II encompassing the ribosomal protein L19 as well as proteins with homologies to components of the hnRNP and snRNP complexes and to the human proliferation-associated p120 antigen. Yeast 10(12):1663-73
    SGD Papers Entry  Pubmed Entry  
    |HEK2 |MCM2 |SHE1
    Alias
    Genetic Interactions
    Mutants/Phenotypes
    Protein Physical Properties
    Strains/Constructs
    Substrates/Ligands/Cofactors
    Techniques and Reagents
    Brandolin G, et al. (1993) Biochemical characterisation of the isolated Anc2 adenine nucleotide carrier from Saccharomyces cerevisiae mitochondria. Biochem Biophys Res Commun 192(1):143-50
    SGD Papers Entry  Pubmed Entry  
    |AAC1 |AAC3
    Mutants/Phenotypes
    Non-Fungal Related Genes/Proteins
    Strains/Constructs
    Brandolin G, et al. (1993) Chemical, immunological, enzymatic, and genetic approaches to studying the arrangement of the peptide chain of the ADP/ATP carrier in the mitochondrial membrane. J Bioenerg Biomembr 25(5):459-72
    SGD Papers Entry  Pubmed Entry  

    Mutants/Phenotypes
    Strains/Constructs
    Meunier B, et al. (1993) Genetic screening in Saccharomyces cerevisiae for large numbers of mitochondrial point mutations which affect structure and function of catalytic subunits of cytochrome-c oxidase. Eur J Biochem 213(1):129-35
    SGD Papers Entry  Pubmed Entry  
    |COX1 |COX2 |COX3
    Alias
    DNA/RNA Sequence Features
    Genetic Interactions
    Mutants/Phenotypes
    Protein/Nucleic Acid Structure
    Strains/Constructs
    Nelson DR and Douglas MG (1993) Function-based mapping of the yeast mitochondrial ADP/ATP translocator by selection for second site revertants. J Mol Biol 230(4):1171-82
    SGD Papers Entry  Pubmed Entry  
    |AAC1
    Alias
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Nelson DR, et al. (1993) Site-directed mutagenesis of the yeast mitochondrial ADP/ATP translocator. Six arginines and one lysine are essential. J Mol Biol 230(4):1159-70
    SGD Papers Entry  Pubmed Entry  

    Alias
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Drgon T, et al. (1992) Yeast ADP/ATP carrier (AAC) proteins exhibit similar enzymatic properties but their deletion produces different phenotypes. FEBS Lett 304(2-3):277-80
    SGD Papers Entry  Pubmed Entry  
    |AAC1 |AAC3
    Alias
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Drgon T, et al. (1991) ADP/ATP translocator is essential only for anaerobic growth of yeast Saccharomyces cerevisiae. FEBS Lett 289(2):159-62
    SGD Papers Entry  Pubmed Entry  
    |AAC1 |AAC3
    Mapping
    Preston RA, et al. (1991) Map positions of pet9, pep1 and pdr4 with respect to CEN2. Yeast 7(8):857-8
    SGD Papers Entry  Pubmed Entry  
    |CEN2 |PEP1
    Alias
    Function/Process
    Genetic Interactions
    Mutants/Phenotypes
    Protein Physical Properties
    Strains/Constructs
    Techniques and Reagents
    Gawaz M, et al. (1990) Structure-function studies of adenine nucleotide transport in mitochondria. II. Biochemical analysis of distinct AAC1 and AAC2 proteins in yeast. J Biol Chem 265(24):14202-8
    SGD Papers Entry  Pubmed Entry  
    |AAC1
    Alias
    Function/Process
    Fungal Related Genes/Proteins
    Genetic Interactions
    Mutants/Phenotypes
    Protein Sequence Features
    RNA Levels and Processing
    Regulation of
    Strains/Constructs
    Kolarov J, et al. (1990) A third ADP/ATP translocator gene in yeast. J Biol Chem 265(21):12711-6
    SGD Papers Entry  Pubmed Entry  
    |AAC1 |AAC3
    Alias
    Genetic Interactions
    Mutants/Phenotypes
    Protein Sequence Features
    Strains/Constructs
    Lawson JE, et al. (1990) Structure-function studies of adenine nucleotide transport in mitochondria. I. Construction and genetic analysis of yeast mutants encoding the ADP/ATP carrier protein of mitochondria. J Biol Chem 265(24):14195-201
    SGD Papers Entry  Pubmed Entry  
    |AAC1
    Alias
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Hapala L (1989) Growth defects in intramitochondrial energy depleted cells: role of mitochondrial biogenesis. Biochem Biophys Res Commun 159(2):612-7
    SGD Papers Entry  Pubmed Entry  

    Alias
    Other Features
    Substrates/Ligands/Cofactors
    Techniques and Reagents
    Knirsch M, et al. (1989) The isolation and reconstitution of the ADP/ATP carrier from wild-type Saccharomyces cerevisiae. Identification of primarily one type (AAC-2). FEBS Lett 244(2):427-32
    SGD Papers Entry  Pubmed Entry  

    Alias
    Function/Process
    Protein Sequence Features
    Substrates/Ligands/Cofactors
    Mayinger P, et al. (1989) The ADP/ATP carrier from yeast (AAC-2) is uniquely suited for the assignment of the binding center by photoaffinity labeling. FEBS Lett 244(2):421-6
    SGD Papers Entry  Pubmed Entry  

    Alias
    DNA/RNA Sequence Features
    Fungal Related Genes/Proteins
    Genetic Interactions
    Non-Fungal Related Genes/Proteins
    Protein Sequence Features
    Strains/Constructs
    Lawson JE and Douglas MG (1988) Separate genes encode functionally equivalent ADP/ATP carrier proteins in Saccharomyces cerevisiae. Isolation and analysis of AAC2. J Biol Chem 263(29):14812-8
    SGD Papers Entry  Pubmed Entry  
    |AAC1
    Cellular Location
    Protein Sequence Features
    Smagula C and Douglas MG (1988) Mitochondrial import of the ADP/ATP carrier protein in Saccharomyces cerevisiae. Sequences required for receptor binding and membrane translocation. J Biol Chem 263(14):6783-90
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  

    Cellular Location
    DNA/RNA Sequence Features
    Fungal Related Genes/Proteins
    Non-Fungal Related Genes/Proteins
    Protein Physical Properties
    Protein Sequence Features
    Adrian GS, et al. (1986) Sequences required for delivery and localization of the ADP/ATP translocator to the mitochondrial inner membrane. Mol Cell Biol 6(2):626-34
    SGD Papers Entry  Pubmed Entry  

    Mapping
    Subik J, et al. (1986) Genetic mapping of nuclear mucidin resistance mutations in Saccharomyces cerevisiae. A new pdr locus on chromosome II. Curr Genet 10(9):665-70
    SGD Papers Entry  Pubmed Entry  
    |LYS2 |PDR3
    Alias
    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Techniques and Reagents
    McEwen JE, et al. (1985) Rapid method for isolation and screening of cytochrome c oxidase-deficient mutants of Saccharomyces cerevisiae. J Bacteriol 161(3):831-5
    SGD Papers Entry  Pubmed Entry  
    |COX6
    Alias
    Cellular Location
    Genetic Interactions
    Mutants/Phenotypes
    Protein Physical Properties
    Strains/Constructs
    Techniques and Reagents
    O'Malley K, et al. (1982) Selection of the nuclear gene for the mitochondrial adenine nucleotide translocator by genetic complementation of the op1 mutation in yeast. J Biol Chem 257(4):2097-103
    SGD Papers Entry  Pubmed Entry  Reference full text  

    Genetic Interactions
    Mutants/Phenotypes
    Strains/Constructs
    Sigler K, et al. (1981) Factors governing substrate-induced generation and extrusion of protons in the yeast Saccharomyces cerevisiae. Biochim Biophys Acta 643(3):572-82
    SGD Papers Entry  Pubmed Entry  

    Alias
    Mutants/Phenotypes
    Strains/Constructs
    Horak J, et al. (1978) Stimulation of amino acid transport in Saccharomyces cerevisiae by metabolic inhibitors. Folia Microbiol (Praha) 23(4):286-91
    SGD Papers Entry  Pubmed Entry  
    |AGP1 |AGP3 |ALP1 |BAP2 |BAP3 |CAN1 |DIP5 |GNP1 |PMA1
    Alias
    Mutants/Phenotypes
    Strains/Constructs
    Lauquin G, et al. (1976) Effect of genetic and physiological manipulations onthe kinetic and binding parameters of the adenine nucleotide translocator in Saccharomyces cervisiae and Candida utilis. Biochimie 58(10):1213-20
    SGD Papers Entry  Pubmed Entry  

    Alias
    Mutants/Phenotypes
    Strains/Constructs
    Ulaszewski S and Lachowicz TM (1975) Specificity and origin of the Mod2- mutation which restores respiratory sufficient phenotype in some pet mutants in Saccharomyces cerevisiae. Acta Microbiol Pol [A] 7(2):77-85
    SGD Papers Entry  Pubmed Entry  

    Alias
    Function/Process
    Mutants/Phenotypes
    Strains/Constructs
    Beck JC, et al. (1968) Genetic modification of energy-conserving systems in yeast mitochondria. Proc Natl Acad Sci U S A 60(1):186-93
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  Reference LINKOUT  

    Function/Process
    Mutants/Phenotypes
    Strains/Constructs
    Kovacova V, et al. (1968) Oxidative phosphorylatiion in yeast. IV. Combination of a nuclear mutation affecting oxidative phosphorylation with cytoplasmic mutation to respiratory deficiency. Biochim Biophys Acta 162(2):157-63
    SGD Papers Entry  Pubmed Entry  

    Alias
    Function/Process
    Mutants/Phenotypes
    Strains/Constructs
    Kovac L, et al. (1967) Biochemical genetics of oxidative phosphorylation. Science 158(808):1564-7
    SGD Papers Entry  Pubmed Entry  Reference LINKOUT  


    Return to SGD
    Send a Message to the SGD Curators

    SGDtm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.