PET9/YBL030C Single Page Format |
|
Contents
- Names and Identifiers
- GO Annotations
- Pathways
- Summary Paragraph
- Mutant Phenotypes
- Interactions
- Homologs
- Protein Info (physical properties, transcript info)
- PDB Homologs (protein structure info)
- Motifs
- Genome-wide Expression
(and other large-scale analyses)- Locus History (misc. notes)
- Sequence Retrieval and Analysis
- Map and Displays
- Localization
- Community Annotation
- Literature Guide
Sequence Coordinates
  ChrII: 164000 to 163044
CDS: 164000 - 163044
Genetic position: -20 cM
Genetic Map DataClick on map for expanded view
SGD ORF map GBrowse SGD Locus Page
| ||||||||
|---|---|---|---|---|---|---|---|---|
| Standard Name | Systematic Name | Alias | Feature Type | SGDID | ||||
| PET9 | YBL030C | AAC2, ANC2, OP1 | ORF, Verified | S000000126 | ||||
| Description | ||||||||
| Major ADP/ATP carrier of the mitochondrial inner membrane, exchanges cytosolic ADP for mitochondrially synthesized ATP; phosphorylated; required for viability in many common lab strains carrying a mutation in the polymorphic SAL1 gene | ||||||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| No pathways available | |||||||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| No summary paragraph available | |||||||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| |||||||||
| |||||||
|---|---|---|---|---|---|---|---|
| Phenotype page for PET9/YBL030C | |||||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Interaction page for PET9/YBL030C | |||||||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 10 20 30 40 50
| | | | |
MSSNAQVKTPLPPAPAPKKESNFLIDFLMGGVSAAVAKTAASPIERVKLL
IQNQDEMLKQGTLDRKYAGILDCFKRTATQEGVISFWRGNTANVIRYFPT
QALNFAFKDKIKAMFGFKKEEGYAKWFAGNLASGGAAGALSLLFVYSLDY
ARTRLAADSKSSKKGGARQFNGLIDVYKKTLKSDGVAGLYRGFLPSVVGI
VVYRGLYFGMYDSLKPLLLTGSLEGSFLASFLLGWVVTTGASTCSYPLDT
VRRRMMMTSGQAVKYDGAFDCLRKIVAAEGVGSLFKGCGANILRGVAGAG
VISMYDQLQMILFGKKFK*
| ||||||||||||||||||||||||||||
| ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ||||||||||||||||||||||||||||
| |||||
|---|---|---|---|---|---|
| You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses. | |||||
| ||||
|---|---|---|---|---|
| Nomenclature History |
|---|
| Standard Name | Reference |
|---|---|
| PET9 | SGD (2007) Information without a citation in SGD |
| Mapping Notes |
| |||||
|---|---|---|---|---|---|
| Sequence Type | Output Format | ||||
| Genomic DNA | GCG | FASTA | NoHeader | ||||
| Genomic DNA with 1 kb up and downstream | GCG | FASTA | NoHeader | ||||
| DNA coding sequence (without introns, without flanking regions) | GCG | FASTA | NoHeader | ||||
| Protein Translation of ORF | GCG | FASTA | NoHeader | ||||
| 6-Frame Translation(with Restriction Map) | GCG | ||||
| Restriction Fragment Sizes | GCG | ||||
| Sequence from other databases | |
|---|---|
| Sequence ID | Source |
| YBL030C | SGD Systematic Sequence |
| 852250 | NCBI: Gene ID |
| NP_009523.1 | NCBI: RefSeq protein version ID |
| NP_009523.1 | NCBI: RefSeq protein version ID |
| 6319441 | NCBI: NCBI protein GI |
| ||||||||
|---|---|---|---|---|---|---|---|---|
| Physical, Genetic Maps: | Chromosomal Feature Map | GBrowse | Combined Physical and Genetic Map | Genetic Distance vs. Physical Distance Ratios | ||||
| Similarity Viewers: | Synteny Viewer | Genomic Stripe View | SAGE Results Map |   | ||||
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| |||||||||
|---|---|---|---|---|---|---|---|---|---|
| No community annotation available. | |||||||||
| ||||||
|---|---|---|---|---|---|---|
| Topics | Reference | Other Genes Addressed | 145 curated references; 0 references not yet curated | |||
| Techniques and Reagents | Amutha B, et al. (2009) Chapter 14 Nucleotide-dependent iron-sulfur cluster biogenesis of endogenous and imported apoproteins in isolated intact mitochondria. Methods Enzymol 456:247-66 | |ACO1 |GGC1 |NFS1 |YAH1 | ||||
| Large-scale protein detection Techniques and Reagents | Braun RJ, et al. (2009) 16-BAC/SDS-PAGE Analysis of Membrane Proteins of Yeast Mitochondria Purified by Free Flow Electrophoresis. Methods Mol Biol 528:83-107 | |ACO1 |ALO1 |ATP1 |ATP2 |ATP7 |HSP60 |IDH2 |ILV5 |KGD2 |NDI1 |PDB1 |POR1 |RIP1 |SSC1 | ||||
| Alias Cross-species Expression Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs | Feng J, et al. (2009) Tyrosine phosphorylation by Src within the cavity of the adenine nucleotide translocase 1 regulates ADP/ATP exchange in mitochondria. Am J Physiol Cell Physiol | |AAC1 |AAC3 | ||||
| Disease Gene Related Techniques and Reagents | Fontanesi F, et al. (2009) Evaluation of the mitochondrial respiratory chain and oxidative phosphorylation system using yeast models of OXPHOS deficiencies. Curr Protoc Hum Genet Chapter 19:Unit19.5 | |ATM1 |ATP6 |BCS1 |COX12 |EMI5 |ERV1 |LSC1 |MEF1 |MIP1 |MIR1 |ORT1 |PIC2 |SDH2 |SOD1 |MORE | ||||
| Cell Cycle Phase Involved Regulation of | Goldberg AA, et al. (2009) Effect of calorie restriction on the metabolic history of chronologically aging yeast. Exp Gerontol 44(9):555-71 | |ABF2 |ACO1 |ACT1 |ADH1 |ADH2 |ALD4 |ARE2 |ATH1 |ATP1 |ATP2 |AYR1 |CAF4 |CCP1 |CIT1 |MORE | ||||
| Techniques and Reagents | Gubbens J, et al. (2009) Photocrosslinking and click chemistry enable the specific detection of proteins interacting with phospholipids at the membrane interface. Chem Biol 16(1):3-14 | |ACO1 |ALD4 |ATP1 |ATP17 |ATP18 |ATP2 |ATP4 |ATP7 |CHC1 |COR1 |COX2 |COX4 |COX9 |COY1 |MORE | ||||
| Function/Process Mutants/Phenotypes Protein Physical Properties Protein Sequence Features | Ohkura K, et al. (2009) Role of C-terminal region of yeast ADP/ATP carrier 2 protein: dynamics of flexible C-terminal arm. Anticancer Res 29(11):4897-900 | |||||
| Function/Process | Olsen LF, et al. (2009) Regulation of glycolytic oscillations by mitochondrial and plasma membrane H+-ATPases. Biophys J 96(9):3850-61 | |ATP1 |ATP14 |ATP15 |ATP16 |ATP17 |ATP18 |ATP19 |ATP2 |ATP20 |ATP3 |ATP4 |ATP5 |ATP6 |ATP7 |MORE | ||||
| Regulation of Transcription | Peiro-Chova L and Estruch F (2009) The yeast RNA polymerase II-associated factor Iwr1p is involved in the basal and regulated transcription of specific genes. J Biol Chem 284(42):28958-67 | |ARG1 |ARG5,6 |ATP15 |ATP16 |ATP17 |ATP19 |ATP3 |ATP7 |BUR6 |COX13 |COX7 |GDH1 |HAP4 |HSP78 |MORE | ||||
| Strains/Constructs Techniques and Reagents | Stuart RA (2009) Chapter 11 Supercomplex organization of the yeast respiratory chain complexes and the ADP/ATP carrier proteins. Methods Enzymol 456:191-208 | |COR1 |COX14 |COX2 |COX5A |QCR2 |SHY1 |TIM17 |TIM23 | ||||
| Evolution Non-Fungal Related Genes/Proteins | Szklarczyk R and Huynen MA (2009) Expansion of the human mitochondrial proteome by intra- and inter-compartmental protein duplication. Genome Biol 10(11):R135 | |AAC1 |AAC3 |AAT2 |ABC1 |ACN9 |ACO1 |ACP1 |ADK1 |ADK2 |AGC1 |AHP1 |ALD4 |ALD5 |ALD6 |MORE | ||||
| Reviews | Traba J, et al. (2009) Transport of adenine nucleotides in the mitochondria of Saccharomyces cerevisiae: Interactions between the ADP/ATP carriers and the ATP-Mg/Pi carrier. Mitochondrion 9(2):79-85 | |||||
| Protein-protein Interactions | Alcock FH, et al. (2008) Conserved substrate binding by chaperones in the bacterial periplasm and the mitochondrial intermembrane space. Biochem J 409(2):377-87 | |POR1 |TIM10 |TIM9 |TOM40 | ||||
| Alias Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs | Azuma M, et al. (2008) Adenine nucleotide translocator transports haem precursors into mitochondria. PLoS ONE 3(8):e3070 | |AAC1 |AAC3 |ATP3 |CTA1 | ||||
| Mutants/Phenotypes Strains/Constructs | Breslow DK, et al. (2008) A comprehensive strategy enabling high-resolution functional analysis of the yeast genome. Nat Methods 5(8):711-8 | |AAR2 |ABD1 |ABF1 |ACC1 |ACP1 |ADE13 |AFG2 |ALA1 |ALG1 |ALG13 |ALG14 |ALG2 |ALG7 |ALR1 |MORE | ||||
| Alias Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Regulation of Strains/Constructs | Claypool SM, et al. (2008) Cardiolipin defines the interactome of the major ADP/ATP carrier protein of the mitochondrial inner membrane. J Cell Biol 182(5):937-50 | |AAC1 |ADH3 |COB |COR1 |COX12 |COX13 |COX2 |COX4 |COX5A |COX6 |CRD1 |CYC1 |CYT1 |DIC1 |MORE | ||||
| Protein-protein Interactions Strains/Constructs | Claypool SM, et al. (2008) The cardiolipin transacylase, tafazzin, associates with two distinct respiratory components providing insight into Barth syndrome. Mol Biol Cell 19(12):5143-55 | |ATP1 |ATP2 |CRD1 |TAZ1 | ||||
| Function/Process Mutants/Phenotypes Protein Sequence Features Strains/Constructs Substrates/Ligands/Cofactors | Clemencon B, et al. (2008) Structure-Function Relationships of the C-Terminal End of the Saccharomyces cerevisiae ADP/ATP Carrier Isoform 2. J Biol Chem 283(17):11218-11225 | |||||
| Alias Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Physical Properties Protein Processing/Modification/Regulation Protein/Nucleic Acid Structure Strains/Constructs Substrates/Ligands/Cofactors | David C, et al. (2008) Two residues of a conserved aromatic ladder of the mitochondrial ADP/ATP carrier are crucial to nucleotide transport. Biochemistry 47(50):13223-31 | |||||
| Protein-protein Interactions Strains/Constructs | Dienhart MK and Stuart RA (2008) The Yeast Aac2 Protein Exists in Physical Association with the Cytochrome bc1-COX Supercomplex and the TIM23 Machinery. Mol Biol Cell 19(9):3934-43 | |COR1 |COX2 |PAM16 |QCR2 |QCR6 |QCR7 |TIM17 |TIM23 |TIM44 |TIM50 | ||||
| Genetic Interactions Mutants/Phenotypes | Hlavata L, et al. (2008) Elevated Ras/protein kinase A activity in Saccharomyces cerevisiae reduces proliferation rate and lifespan by two different reactive oxygen species-dependent routes. Aging Cell 7(2):148-57 | |BCY1 |RAS2 |SOD1 | ||||
| Alias Cross-species Expression Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Sequence Features Strains/Constructs | Iwahashi A, et al. (2008) Functionally important conserved length of C-terminal regions of yeast and bovine ADP/ATP carriers, identified by deletion mutants studies, and water accessibility of the amino acids at the C-terminal region of the yeast carrier. Mitochondrion 8(2):196-204 | |||||
| Non-Fungal Related Genes/Proteins Protein Sequence Features Strains/Constructs | Kihira Y (2008) Functional Interactions between Transmembrane Regions and Their C-Terminal Adjoining Loop in Mitochondrial ADP/ATP Carrier. Biol Pharm Bull 31(11):2001-6 | |||||
| Alias Function/Process Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs | Kucejova B, et al. (2008) Pleiotropic effects of the yeast Sal1 and Aac2 carriers on mitochondrial function via an activity distinct from adenine nucleotide transport. Mol Genet Genomics 280(1):25-39 | |AAC1 |GGC1 |MTG1 |SAL1 |SHY1 | ||||
| Alias Genetic Interactions Mutants/Phenotypes Strains/Constructs | Mroczek S and Kufel J (2008) Apoptotic signals induce specific degradation of ribosomal RNA in yeast. Nucleic Acids Res 36(9):2874-88 | |AAC1 |AAC3 |AHP1 |AIF1 |DOT5 |GPX1 |GPX2 |GRX1 |GRX2 |GSH1 |HTB1 |HTB2 |HYR1 |MCA1 |MORE | ||||
| Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs | Smith CP and Thorsness PE (2008) The Molecular Basis for Relative Physiological Functionality of the ADP/ATP Carrier Isoforms in Saccharomyces cerevisiae. Genetics 179(3):1285-99 | |AAC1 |AAC3 |SAL1 | ||||
| Reviews | Stuart RA (2008) Supercomplex organization of the oxidative phosphorylation enzymes in yeast mitochondria. J Bioenerg Biomembr 40(5):411-7 | |ATP1 |ATP14 |ATP15 |ATP16 |ATP17 |ATP18 |ATP19 |ATP2 |ATP20 |ATP3 |ATP4 |ATP5 |ATP6 |ATP7 |MORE | ||||
| Alias Function/Process Genetic Interactions Strains/Constructs Substrates/Ligands/Cofactors | Traba J, et al. (2008) Yeast mitochondria import ATP through the calcium-dependent ATP-Mg/Pi carrier Sal1p, and are ATP consumers during aerobic growth in glucose. Mol Microbiol 69(3):570-85 | |AAC1 |MRS2 |SAL1 | ||||
| Disease Gene Related Function/Process Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Sequence Features Strains/Constructs | Wang X, et al. (2008) Dominant membrane uncoupling by mutant adenine nucleotide translocase in mitochondrial diseases. Hum Mol Genet 17(24):4036-44 | |||||
| Alias Disease Gene Related Function/Process Genetic Interactions Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs | Wang X, et al. (2008) Reduced cytosolic protein synthesis suppresses mitochondrial degeneration. Nat Cell Biol 10(9):1090-7 | |ATP1 |COX2 |COX4 |CYT1 |FOB1 |GPR1 |HSP60 |PHB1 |PHB2 |REI1 |RPD3 |RPL31A |RPL6B |SCH9 |MORE | ||||
| Alias Cellular Location Function/Process Mutants/Phenotypes Protein Processing/Modification/Regulation Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs | Bamber L, et al. (2007) The yeast mitochondrial ADP/ATP carrier functions as a monomer in mitochondrial membranes. Proc Natl Acad Sci U S A 104(26):10830-4 | |||||
| Function/Process Strains/Constructs Substrates/Ligands/Cofactors Techniques and Reagents | Bamber L, et al. (2007) Yeast Mitochondrial ADP/ATP Carriers Are Monomeric in Detergents as Demonstrated by Differential Affinity Purification. J Mol Biol 371(2):388-95 | |||||
| Alias Genetic Interactions Protein-protein Interactions Strains/Constructs | Buttner S, et al. (2007) Endonuclease g regulates budding yeast life and death. Mol Cell 25(2):233-46 | |AAC1 |AAC3 |AIF1 |HHF1 |HHF2 |HTB1 |HTB2 |KAP123 |MCA1 |NUC1 |POR1 | ||||
| Protein-protein Interactions | Davis AJ, et al. (2007) The Tim9p/10p and Tim8p/13p complexes bind to specific sites on Tim23p during mitochondrial protein import. Mol Biol Cell 18(2):475-86 | |TIM10 |TIM13 |TIM23 |TIM8 |TIM9 | ||||
| Alias Non-Fungal Related Genes/Proteins Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs Substrates/Ligands/Cofactors | Kihira Y, et al. (2007) Difference between Yeast and Bovine Mitochondrial ADP/ATP Carriers in Terms of Conformational Properties of the First Matrix Loop as Deduced by Use of Copper-o-phenanthroline. Biol Pharm Bull 30(5):885-90 | |AAC1 | ||||
| Protein-protein Interactions | Mick DU, et al. (2007) Shy1 couples Cox1 translational regulation to cytochrome c oxidase assembly. EMBO J 26(20):4347-58 | |COA1 |COR1 |COX1 |COX14 |COX2 |COX3 |COX4 |COX5A |CYT1 |MSS51 |QCR2 |QCR6 |RIP1 |SHY1 | ||||
| Function/Process Mutants/Phenotypes Strains/Constructs | Pereira C, et al. (2007) ADP/ATP carrier is required for mitochondrial outer membrane permeabilization and cytochrome c release in yeast apoptosis. Mol Microbiol 66(3):571-82 ![]() | |AAC1 |AAC3 |ATP2 |CPR3 |MCA1 |POR1 | ||||
| Protein Processing/Modification/Regulation Protein Sequence Features | Reinders J, et al. (2007) Profiling phosphoproteins of yeast mitochondria reveals a role of phosphorylation in assembly of the ATP synthase. Mol Cell Proteomics 6(11):1896-906 | |AAC1 |ACH1 |ACO1 |ADY2 |ALD4 |ATO2 |ATO3 |ATP1 |ATP15 |ATP16 |ATP2 |ATP20 |ATP4 |ATP5 |MORE | ||||
| Function/Process Strains/Constructs Techniques and Reagents | Rey M, et al. (2007) The Saccharomyces cerevisiae ADP/ATP carrier-iso 1 cytochrome c fusion protein: One-step purification and functional analysis in vitro. Biochimie 89(9):1070-1079 | |CYC1 | ||||
| Regulation of | de Groot MJ, et al. (2007) Quantitative proteomics and transcriptomics of anaerobic and aerobic yeast cultures reveals post-transcriptional regulation of key cellular processes. Microbiology 153(Pt 11):3864-3878 | |ACO1 |ACO2 |ACS1 |ACS2 |ADE13 |ADE17 |ADE2 |ADE3 |ADE4 |ADE5,7 |ADE6 |ADH1 |ADH2 |ADH5 |MORE | ||||
| Cellular Location Protein-protein Interactions Techniques and Reagents | Brandina I, et al. (2006) Enolase takes part in a macromolecular complex associated to mitochondria in yeast. Biochim Biophys Acta 1757(9-10):1217-1228 | |ACO1 |ATP1 |ATP2 |CDC19 |CIT1 |CIT3 |COX2 |ENO1 |ENO2 |FBA1 |GPM1 |HXK1 |HXK2 |MDH1 |MORE | ||||
| Evolution Fungal Related Genes/Proteins | De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81 | |AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE | ||||
| Cross-species Expression Fungal Related Genes/Proteins | Fontanesi F, et al. (2006) Heterologous complementation of the Klaac null mutation of Kluyveromyces lactis by the Saccharomyces cerevisiae AAC3 gene encoding the ADP/ATP carrier. FEMS Yeast Res 6(3):414-20 | |AAC1 |AAC3 | ||||
| Function/Process Mutants/Phenotypes Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs | Iwahashi A, et al. (2006) The structure of the second cytosolic loop of the yeast mitochondrial ADP/ATP carrier AAC2 is dependent on the conformational state. Mitochondrion 6(5):245-51 | |||||
| Function/Process Mutants/Phenotypes Protein Sequence Features | Kihira Y, et al. (2006) Roles of adjoining Asp and Cys residues of first matrix-facing loop in transport activity of yeast and bovine mitochondrial ADP/ATP carriers. J Biochem 139(3):575-82 | |||||
| Alias Cross-species Expression Disease Gene Related Non-Fungal Related Genes/Proteins Strains/Constructs | Lodi T, et al. (2006) Mutation D104G in ANT1 gene: complementation study in Saccharomyces cerevisiae as a model system. Biochem Biophys Res Commun 341(3):810-5 | |AAC1 | ||||
| Regulation of Transcription | Mojzita D and Hohmann S (2006) Pdc2 coordinates expression of the THI regulon in the yeast Saccharomyces cerevisiae. Mol Genet Genomics 276(2):147-61 | |ARO10 |FSH1 |INO1 |IPP1 |ITR1 |KGD2 |MDH1 |NRT1 |OLE1 |PDC1 |PDC2 |PDC5 |PET18 |PHO3 |MORE | ||||
| Reviews | Palmieri F, et al. (2006) Identification of mitochondrial carriers in Saccharomyces cerevisiae by transport assay of reconstituted recombinant proteins. Biochim Biophys Acta 1757(9-10):1249-62 | |AAC1 |AAC3 |AGC1 |ANT1 |CAT2 |CRC1 |CTP1 |DIC1 |FLX1 |GGC1 |LEU5 |MIR1 |MRS3 |MRS4 |MORE | ||||
| Cellular Location | Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54 | |AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACN9 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |MORE | ||||
| Fungal Related Genes/Proteins Mutants/Phenotypes | Snoek IS and Steensma HY (2006) Why does Kluyveromyces lactis not grow under anaerobic conditions? Comparison of essential anaerobic genes of Saccharomyces cerevisiae with the Kluyveromyces lactis genome. FEMS Yeast Res 6(3):393-403 | |ACP1 |ARB1 |ARG82 |ARH1 |ARV1 |ATM1 |BTS1 |BUR6 |CAB2 |CAX4 |CDC40 |CNM67 |CTF4 |DBP7 |MORE | ||||
| Protein Processing/Modification/Regulation Protein-protein Interactions Techniques and Reagents | Tagwerker C, et al. (2006) A tandem affinity tag for two-step purification under fully denaturing conditions: application in ubiquitin profiling and protein complex identification combined with in vivocross-linking. Mol Cell Proteomics 5(4):737-48 | |AAC1 |AAC3 |ACB1 |ACC1 |ACS2 |ADE3 |ADE5,7 |ADE6 |ADH4 |ADO1 |AGP1 |AHA1 |AHP1 |ALA1 |MORE | ||||
| Reviews | Arco AD and Satrustegui J (2005) New mitochondrial carriers: an overview. Cell Mol Life Sci 62(19-20):2204-27 | |AAC1 |AGC1 |ANT1 |CRC1 |CTP1 |DIC1 |FLX1 |GGC1 |LEU5 |MIR1 |MRS3 |MRS4 |MTM1 |OAC1 |MORE | ||||
| Genetic Interactions Mutants/Phenotypes Strains/Constructs | Cavero S, et al. (2005) The calcium-dependent ATP-Mg/Pi mitochondrial carrier is a target of glucose-induced calcium signalling in Saccharomyces cerevisiae. Biochem J 392(Pt 3):537-44 | |AAC1 |AAC3 |SAL1 | ||||
| Cellular Location Function/Process Mutants/Phenotypes Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs | Dahout-Gonzalez C, et al. (2005) Conformation-dependent swinging of the matrix loop m2 of the mitochondrial Saccharomyces cerevisiae ADP/ATP carrier. Biochemistry 44(49):16310-20 | |||||
| Function/Process Strains/Constructs | Dassa EP, et al. (2005) Functional characterization and purification of a Saccharomyces cerevisiae ADP/ATP carrier-iso 1 cytochrome c fusion protein. Protein Expr Purif 40(2):358-69 | |CYC1 | ||||
| Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs | Dzugasova V and Subik J (2005) Synthetic lethal interaction between the pel1 and op1 mutations in Saccharomyces cerevisiae. Folia Microbiol (Praha) 50(4):293-9 | |CRD1 |PGS1 | ||||
| Function/Process Mutants/Phenotypes Protein Physical Properties Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs | Kihira Y, et al. (2005) Cysteine labeling studies detect conformational changes in region 106-132 of the mitochondrial ADP/ATP carrier of Saccharomyces cerevisiae. Biochemistry 44(1):184-92 | |||||
| Cross-species Expression Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Strains/Constructs | Mentel M, et al. (2005) Triplicate genes for mitochondrial ADP/ATP carriers in the aerobic yeast Yarrowia lipolytica are regulated differentially in the absence of oxygen. Mol Genet Genomics 273(1):84-91 | |||||
| Cross-species Expression Mutants/Phenotypes Protein Sequence Features | Monne M, et al. (2005) Functional expression of eukaryotic membrane proteins in Lactococcus lactis. Protein Sci 14(12):3048-56 | |AAC1 |AAC3 |DIC1 |GGC1 |MIR1 |OAC1 |ODC1 |ODC2 |PET8 | ||||
| Disease Gene Related Function/Process Mutants/Phenotypes Strains/Constructs | Palmieri L, et al. (2005) Complete loss-of-function of the heart/muscle-specific adenine nucleotide translocator is associated with mitochondrial myopathy and cardiomyopathy. Hum Mol Genet 14(20):3079-88 | |||||
| Function/Process Strains/Constructs Substrates/Ligands/Cofactors | Postis V, et al. (2005) Subunits of the yeast mitochondrial ADP/ATP carrier: cooperation within the dimer. Biochemistry 44(45):14732-40 | |MIR1 | ||||
| RNA Levels and Processing Regulation of Transcription | Puig S, et al. (2005) Coordinated remodeling of cellular metabolism during iron deficiency through targeted mRNA degradation. Cell 120(1):99-110 | |ACO1 |AFT1 |AFT2 |CCC1 |CCP1 |CIR2 |CIT1 |CIT3 |COQ6 |COR1 |COX4 |COX6 |COX8 |COX9 |MORE | ||||
| Cellular Location Protein Sequence Features | Vergnolle MA, et al. (2005) A cryptic matrix targeting signal of the yeast ADP/ATP carrier normally inserted by the TIM22 complex is recognized by the TIM23 machinery. Biochem J 385(Pt 1):173-80 | |TIM10 |TIM12 |TIM22 |TIM23 | ||||
| Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Strains/Constructs | Chen XJ (2004) Sal1p, a calcium-dependent carrier protein that suppresses an essential cellular function associated With the Aac2 isoform of ADP/ATP translocase in Saccharomyces cerevisiae. Genetics 167(2):607-17 | |AAC1 |AAC3 |SAL1 | ||||
| Alias Disease Gene Related Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs | Fontanesi F, et al. (2004) Mutations in AAC2, equivalent to human adPEO-associated ANT1 mutations, lead to defective oxidative phosphorylation in Saccharomyces cerevisiae and affect mitochondrial DNA stability. Hum Mol Genet 13(9):923-34 | |||||
| Reviews | Reichert AS and Neupert W (2004) Mitochondriomics or what makes us breathe. Trends Genet 20(11):555-62 | |ATM1 |FZO1 |HSP60 |ISC1 |MGM1 |OXA1 |POR1 |SSC1 |TIM22 |TIM23 |TIM8 |YFH1 | ||||
| Fungal Related Genes/Proteins | Zhang Z and Kishino H (2004) Genomic background predicts the fate of duplicated genes: evidence from the yeast genome. Genetics 166(4):1995-9 | |AAC1 |ALD4 |ALD5 |BDH1 |BDH2 |CAM1 |CCT4 |CCT6 |CDC19 |CLB3 |CLB4 |CYS3 |DCS1 |DCS2 |MORE | ||||
| Genetic Interactions Mutants/Phenotypes Strains/Constructs | Dunn CD and Jensen RE (2003) Suppression of a defect in mitochondrial protein import identifies cytosolic proteins required for viability of yeast cells lacking mitochondrial DNA. Genetics 165(1):35-45 | |ATP2 |CCT6 |COQ4 |CYT1 |ICY1 |PBP1 |SSB1 |TIM10 |TIM18 |TIM22 |TIM54 |TIP41 |TOM70 |YME1 | ||||
| Cellular Location Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Strains/Constructs | Dyall SD, et al. (2003) The dynamic dimerization of the yeast ADP/ATP carrier in the inner mitochondrial membrane is affected by conserved cysteine residues. J Biol Chem 278(29):26757-64 | |AAC1 |TIM10 |TIM22 | ||||
| Strains/Constructs Techniques and Reagents | Kunji ER, et al. (2003) Lactococcus lactis as host for overproduction of functional membrane proteins. Biochim Biophys Acta 1610(1):97-108 | |||||
| Protein Physical Properties Protein/Nucleic Acid Structure | Lorenz-Fonfria VA, et al. (2003) Structural and functional implications of the instability of the ADP/ATP transporter purified from mitochondria as revealed by FTIR spectroscopy. Biophys J 85(1):255-66 | |||||
| Cellular Location Protein Sequence Features Protein/Nucleic Acid Structure Techniques and Reagents | Panneels V, et al. (2003) Choline head groups stabilize the matrix loop regions of the ATP/ADP carrier ScAAC2. Biochem Biophys Res Commun 300(1):65-74 | |||||
| Cellular Location | Sickmann A, et al. (2003) The proteome of Saccharomyces cerevisiae mitochondria. Proc Natl Acad Sci U S A 100(23):13207-12 | |AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |ADK2 |MORE | ||||
| Function/Process Mutants/Phenotypes Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs | Zeman I, et al. (2003) Four mutations in transmembrane domains of the mitochondrial ADP/ATP carrier increase resistance to bongkrekic acid. J Bioenerg Biomembr 35(3):243-56 | |||||
| Regulation of Transcription | Zhang W, et al. (2003) Microarray analyses of the metabolic responses of Saccharomyces cerevisiae to organic solvent dimethyl sulfoxide. J Ind Microbiol Biotechnol 30(1):57-69 | |AAH1 |ABP140 |ACS2 |ADE1 |ADE12 |ADE17 |ADE4 |ADE8 |ADH2 |ADH4 |ADH5 |ADK1 |ADO1 |ALD3 |MORE | ||||
| Function/Process Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs | Chen XJ (2002) Induction of an unregulated channel by mutations in adenine nucleotide translocase suggests an explanation for human ophthalmoplegia. Hum Mol Genet 11(16):1835-43 | |||||
| Cellular Location | Jensen RE and Dunn CD (2002) Protein import into and across the mitochondrial inner membrane: role of the TIM23 and TIM22 translocons. Biochim Biophys Acta 1592(1):25-34 | |TIM22 |TIM23 |TIM54 | ||||
| RNA Levels and Processing Regulation of | Palkova Z, et al. (2002) Ammonia pulses and metabolic oscillations guide yeast colony development. Mol Biol Cell 13(11):3901-14 | |AAC3 |AAT1 |ACO1 |ACS1 |ADY2 |ALD4 |ALD5 |ATO2 |ATO3 |ATP15 |ATP2 |CAT2 |CHA1 |CIT3 |MORE | ||||
| Cellular Location | Truscott KN, et al. (2002) Mitochondrial import of the ADP/ATP carrier: the essential TIM complex of the intermembrane space is required for precursor release from the TOM complex. Mol Cell Biol 22(22):7780-9 | |MGE1 |TIM10 |TIM12 |TIM13 |TIM17 |TIM18 |TIM22 |TIM23 |TIM44 |TIM54 |TIM8 |TIM9 |TOM20 |TOM22 |MORE | ||||
| Alias Cellular Location Mutants/Phenotypes Protein Sequence Features Strains/Constructs Substrates/Ligands/Cofactors Techniques and Reagents | Hatanaka T, et al. (2001) Characterization of loops of the yeast mitochondrial ADP/ATP carrier facing the cytosol by site-directed mutagenesis. Biochem Biophys Res Commun 286(5):936-42 | |||||
| Alias DNA/RNA Sequence Features Function/Process Non-Fungal Related Genes/Proteins Protein Sequence Features Strains/Constructs | Hatanaka T, et al. (2001) Significant effect of the N-terminal region of the mitochondrial ADP/ATP carrier on its efficient expression in yeast mitochondria. J Biol Chem 276(31):28881-8 | |||||
| Non-Fungal Related Genes/Proteins | Heimpel S, et al. (2001) Expression of the mitochondrial ADP/ATP carrier in Escherichia coli. Renaturation, reconstitution, and the effect of mutations on 10 positive residues. J Biol Chem 276(15):11499-506 | |AAC1 | ||||
| Alias Cellular Location DNA/RNA Sequence Features Function/Process Mutants/Phenotypes Protein Physical Properties Substrates/Ligands/Cofactors | Huang SG, et al. (2001) Chimers of two fused ADP/ATP carrier monomers indicate a single channel for ADP/ATP transport. Arch Biochem Biophys 394(1):67-75 | |||||
| Cellular Location Protein-protein Interactions Regulation of Strains/Constructs | Wiedemann N, et al. (2001) The three modules of ADP/ATP carrier cooperate in receptor recruitment and translocation into mitochondria. EMBO J 20(5):951-60 | |AAC1 |AAC3 |TOM70 | ||||
| Reviews | Chen XJ and Clark-Walker GD (2000) The petite mutation in yeasts: 50 years on. Int Rev Cytol 194:197-238 | |PGS1 |YME1 | ||||
| Function/Process Protein Sequence Features Strains/Constructs Substrates/Ligands/Cofactors Techniques and Reagents | Dianoux AC, et al. (2000) Two distinct regions of the yeast mitochondrial ADP/ATP carrier are photolabeled by a new ADP analogue: 2-azido-3'-O-naphthoyl-[beta-32P]ADP. Identification of the binding segments by mass spectrometry. Biochemistry 39(37):11477-87 | |||||
| Function/Process Non-Fungal Related Genes/Proteins Other Features | Dyall SD, et al. (2000) Presence of a member of the mitochondrial carrier family in hydrogenosomes: conservation of membrane-targeting pathways between hydrogenosomes and mitochondria. Mol Cell Biol 20(7):2488-97 | |AAC1 |AAC3 |TIM10 |TIM9 | ||||
| Alias Function/Process Substrates/Ligands/Cofactors Techniques and Reagents | Fiore C, et al. (2000) Purification of histidine-tagged mitochondrial ADP/ATP carrier: influence of the conformational states of the C-terminal region. Protein Expr Purif 19(1):57-65 | |AAC1 |AAC3 | ||||
| Mutants/Phenotypes Other Features Strains/Constructs | Harris MH, et al. (2000) Role of oxidative phosphorylation in Bax toxicity. Mol Cell Biol 20(10):3590-6 | |ATP4 |COX4 |COX7 |CYC3 |NDI1 |POR1 |QCR7 |SDH3 | ||||
| Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs | Kissova I, et al. (2000) The cytotoxic action of Bax on yeast cells does not require mitochondrial ADP/ATP carrier but may be related to its import to the mitochondria. FEBS Lett 471(1):113-8 | |AAC1 |AAC3 | ||||
| Function/Process Mutants/Phenotypes Substrates/Ligands/Cofactors Techniques and Reagents | Lunde CS and Kubo I (2000) Effect of polygodial on the mitochondrial ATPase of Saccharomyces cerevisiae. Antimicrob Agents Chemother 44(7):1943-53 | |PMA1 | ||||
| Function/Process Protein Sequence Features Protein-protein Interactions Substrates/Ligands/Cofactors Techniques and Reagents | Trezeguet V, et al. (2000) A covalent tandem dimer of the mitochondrial ADP/ATP carrier is functional in vivo. Biochim Biophys Acta 1457(1-2):81-93 | |||||
| Function/Process Other Features | Chen XJ and Clark-Walker GD (1999) Alpha and beta subunits of F1-ATPase are required for survival of petite mutants in Saccharomyces cerevisiae. Mol Gen Genet 262(4-5):898-908 | |ATP1 |ATP15 |ATP16 |ATP2 |PGS1 |YME1 | ||||
| RNA Levels and Processing Regulation of | Ferea TL, et al. (1999) Systematic changes in gene expression patterns following adaptive evolution in yeast. Proc Natl Acad Sci U S A 96(17):9721-6 | |ACO1 |ACS1 |ADE5,7 |ADH1 |ADH2 |ALD4 |ALD6 |ATP1 |ATP14 |ATP16 |ATP17 |ATP3 |ATP4 |ATP5 |MORE | ||||
| Cellular Location Function/Process Protein-protein Interactions | Hatanaka T, et al. (1999) Functional expression of the tandem-repeated homodimer of the mitochondrial ADP/ATP carrier in Saccharomyces cerevisiae. Biochem Biophys Res Commun 262(3):726-30 | |||||
| Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Strains/Constructs | Nebohacova M, et al. (1999) Isolation and expression of the gene encoding mitochondrial ADP/ATP carrier (AAC) from the pathogenic yeast Candida parapsilosis. Yeast 15(12):1237-42 | |AAC3 | ||||
| Protein Processing/Modification/Regulation Protein-protein Interactions | Ryan MT, et al. (1999) Functional staging of ADP/ATP carrier translocation across the outer mitochondrial membrane. J Biol Chem 274(29):20619-27 | |AAC1 |AAC3 |SAM37 |TIM10 |TOM20 |TOM40 |TOM70 | ||||
| Alias Fungal Related Genes/Proteins | Viola AM, et al. (1999) A Klaac null mutant of Kluyveromyces lactis is complemented by a single copy of the Saccharomyces cerevisiae AAC1 gene. Curr Genet 36(1-2):29-36 | |AAC1 |HAP2 | ||||
| Cellular Location Protein Processing/Modification/Regulation | Kubrich M, et al. (1998) The import route of ADP/ATP carrier into mitochondria separates from the general import pathway of cleavable preproteins at the trans side of the outer membrane. J Biol Chem 273(26):16374-81 | |TOM22 |TOM7 |TOM70 | ||||
| Alias Mutants/Phenotypes Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs | Nelson DR, et al. (1998) Highly conserved charge-pair networks in the mitochondrial carrier family. J Mol Biol 277(2):285-308 | |||||
| Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Strains/Constructs | Joseph-Liauzun E, et al. (1997) The Mr 18,000 subunit of the peripheral-type benzodiazepine receptor exhibits both benzodiazepine and isoquinoline carboxamide binding sites in the absence of the voltage-dependent anion channel or of the adenine nucleotide carrier. J Biol Chem 272(44):28102-6 | |AAC1 |AAC3 |POR1 | ||||
| Alias Function/Process Mutants/Phenotypes Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs Substrates/Ligands/Cofactors Techniques and Reagents | Muller V, et al. (1997) Mutagenesis of some positive and negative residues occurring in repeat triad residues in the ADP/ATP carrier from yeast. Biochemistry 36(50):16008-18 | |||||
| Alias Mutants/Phenotypes Strains/Constructs | Polcic P, et al. (1997) Fatty acids induced uncoupling of Saccharomyces cerevisiae mitochondria requires an intact ADP/ATP carrier. FEBS Lett 412(1):207-10 | |||||
| Alias Mutants/Phenotypes Strains/Constructs | Roucou X, et al. (1997) Conditions allowing different states of ATP- and GDP-induced permeability in mitochondria from different strains of Saccharomyces cerevisiae. Biochim Biophys Acta 1324(1):120-32 | |||||
| Cellular Location Function/Process Fungal Related Genes/Proteins Protein Physical Properties Protein Sequence Features Protein/Nucleic Acid Structure | el Moualij B, et al. (1997) Phylogenetic classification of the mitochondrial carrier family of Saccharomyces cerevisiae. Yeast 13(6):573-81 | |AAC1 |AAC3 |AGC1 |ANT1 |CRC1 |CTP1 |DIC1 |FLX1 |GGC1 |LEU5 |MIR1 |MRS3 |MRS4 |MTM1 |MORE | ||||
| Alias Cross-species Expression Fungal Related Genes/Proteins Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs | Couzin N, et al. (1996) Cloning of the gene encoding the mitochondrial adenine nucleotide carrier of Schizosaccharomyces pombe by functional complementation in Saccharomyces cerevisiae. Gene 171(1):113-7 | |AAC1 |AAC3 | ||||
| Alias Cellular Location Function/Process Fungal Related Genes/Proteins | Gavurnikova G, et al. (1996) Transcription of the AAC1 gene encoding an isoform of mitochondrial ADP/ATP carrier in Saccharomyces cerevisiae is regulated by oxygen in a heme-independent manner. Eur J Biochem 239(3):759-63 | |AAC1 |AAC3 | ||||
| Alias Mutants/Phenotypes Protein Sequence Features Strains/Constructs Substrates/Ligands/Cofactors | Le Saux A, et al. (1996) Conformational changes of the yeast mitochondrial adenosine diphosphate/adenosine triphosphate carrier studied through its intrinsic fluorescence. 1. Tryptophanyl residues of the carrier can be mutated without impairing protein activity. Biochemistry 35(50):16116-24 | |||||
| Alias Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein/Nucleic Acid Structure Strains/Constructs Techniques and Reagents | Muller V, et al. (1996) Probing the role of positive residues in the ADP/ATP carrier from yeast. The effect of six arginine mutations of oxidative phosphorylation and AAC expression. Biochemistry 35(50):16132-43 | |||||
| Alias Regulation of | Nebohacova M, et al. (1996) Oxygen- and carbon source-dependent transactivation effect of ABF1 on the expression of the AAC2 gene encoding mitochondrial ADP/ATP carrier. Folia Microbiol (Praha) 41(1):115-6 | |ABF1 |CHA4 | ||||
| Alias Protein Physical Properties Protein Sequence Features Protein/Nucleic Acid Structure Substrates/Ligands/Cofactors | Roux P, et al. (1996) Conformational changes of the yeast mitochondrial adenosine diphosphate/adenosine triphosphate carrier studied through its intrinsic fluorescence. 2. Assignment of tryptophanyl residues of the carrier to the responses to specific ligands. Biochemistry 35(50):16125-31 | |||||
| Mapping | Song JM, et al. (1996) Organization and characterization of the two yeast ribosomal protein YL19 genes. Curr Genet 30(4):273-8 | |RPL19A |RPL19B |YBL028C |YBL029W | ||||
| Alias DNA/RNA Sequence Features Fungal Related Genes/Proteins Mutants/Phenotypes Protein Processing/Modification/Regulation RNA Levels and Processing Regulation of Strains/Constructs | Betina S, et al. (1995) Expression of the AAC2 gene encoding the major mitochondrial ADP/ATP carrier in Saccharomyces cerevisiae is controlled at the transcriptional level by oxygen, heme and HAP2 factor. Eur J Biochem 229(3):651-7 | |AAC1 |AAC3 |ABF1 |HAP2 |HAP3 | ||||
| Cellular Location Protein Processing/Modification/Regulation | Haucke V, et al. (1995) The yeast mitochondrial protein import receptor Mas20p binds precursor proteins through electrostatic interaction with the positively charged presequence. J Biol Chem 270(10):5565-70 | |HSP10 |HSP60 |RIP1 |SAM37 |TOM20 |TOM22 |TOM70 | ||||
| Alias Cross-species Expression Fungal Related Genes/Proteins Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs | Viola AM, et al. (1995) A kluyveromyces lactis gene homologue to AAC2 complements the Saccaromyces cerevisiae op1 mutation. Curr Genet 27(3):229-33 | |AAC1 | ||||
| Alias Function/Process Mutants/Phenotypes Protein Physical Properties Protein/Nucleic Acid Structure Strains/Constructs Techniques and Reagents | Hoffmann B, et al. (1994) The reconstituted ADP/ATP carrier activity has an absolute requirement for cardiolipin as shown in cysteine mutants. J Biol Chem 269(3):1940-4 | |AAC1 | ||||
| Mutants/Phenotypes Strains/Constructs | Kule C, et al. (1994) Doxorubicin, daunorubicin, and mitoxantrone cytotoxicity in yeast. Mol Pharmacol 46(6):1234-40 | |||||
| Alias Mapping | Van Dyck L, et al. (1994) Analysis of a 17.4 kb DNA segment of yeast chromosome II encompassing the ribosomal protein L19 as well as proteins with homologies to components of the hnRNP and snRNP complexes and to the human proliferation-associated p120 antigen. Yeast 10(12):1663-73 | |HEK2 |MCM2 |SHE1 | ||||
| Alias Genetic Interactions Mutants/Phenotypes Protein Physical Properties Strains/Constructs Substrates/Ligands/Cofactors Techniques and Reagents | Brandolin G, et al. (1993) Biochemical characterisation of the isolated Anc2 adenine nucleotide carrier from Saccharomyces cerevisiae mitochondria. Biochem Biophys Res Commun 192(1):143-50 | |AAC1 |AAC3 | ||||
| Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs | Brandolin G, et al. (1993) Chemical, immunological, enzymatic, and genetic approaches to studying the arrangement of the peptide chain of the ADP/ATP carrier in the mitochondrial membrane. J Bioenerg Biomembr 25(5):459-72 | |||||
| Mutants/Phenotypes Strains/Constructs | Meunier B, et al. (1993) Genetic screening in Saccharomyces cerevisiae for large numbers of mitochondrial point mutations which affect structure and function of catalytic subunits of cytochrome-c oxidase. Eur J Biochem 213(1):129-35 | |COX1 |COX2 |COX3 | ||||
| Alias DNA/RNA Sequence Features Genetic Interactions Mutants/Phenotypes Protein/Nucleic Acid Structure Strains/Constructs | Nelson DR and Douglas MG (1993) Function-based mapping of the yeast mitochondrial ADP/ATP translocator by selection for second site revertants. J Mol Biol 230(4):1171-82 | |AAC1 | ||||
| Alias Genetic Interactions Mutants/Phenotypes Strains/Constructs | Nelson DR, et al. (1993) Site-directed mutagenesis of the yeast mitochondrial ADP/ATP translocator. Six arginines and one lysine are essential. J Mol Biol 230(4):1159-70 | |||||
| Alias Genetic Interactions Mutants/Phenotypes Strains/Constructs | Drgon T, et al. (1992) Yeast ADP/ATP carrier (AAC) proteins exhibit similar enzymatic properties but their deletion produces different phenotypes. FEBS Lett 304(2-3):277-80 | |AAC1 |AAC3 | ||||
| Alias Genetic Interactions Mutants/Phenotypes Strains/Constructs | Drgon T, et al. (1991) ADP/ATP translocator is essential only for anaerobic growth of yeast Saccharomyces cerevisiae. FEBS Lett 289(2):159-62 | |AAC1 |AAC3 | ||||
| Mapping | Preston RA, et al. (1991) Map positions of pet9, pep1 and pdr4 with respect to CEN2. Yeast 7(8):857-8 | |CEN2 |PEP1 | ||||
| Alias Function/Process Genetic Interactions Mutants/Phenotypes Protein Physical Properties Strains/Constructs Techniques and Reagents | Gawaz M, et al. (1990) Structure-function studies of adenine nucleotide transport in mitochondria. II. Biochemical analysis of distinct AAC1 and AAC2 proteins in yeast. J Biol Chem 265(24):14202-8 | |AAC1 | ||||
| Alias Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Protein Sequence Features RNA Levels and Processing Regulation of Strains/Constructs | Kolarov J, et al. (1990) A third ADP/ATP translocator gene in yeast. J Biol Chem 265(21):12711-6 | |AAC1 |AAC3 | ||||
| Alias Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs | Lawson JE, et al. (1990) Structure-function studies of adenine nucleotide transport in mitochondria. I. Construction and genetic analysis of yeast mutants encoding the ADP/ATP carrier protein of mitochondria. J Biol Chem 265(24):14195-201 | |AAC1 | ||||
| Alias Genetic Interactions Mutants/Phenotypes Strains/Constructs | Hapala L (1989) Growth defects in intramitochondrial energy depleted cells: role of mitochondrial biogenesis. Biochem Biophys Res Commun 159(2):612-7 | |||||
| Alias Other Features Substrates/Ligands/Cofactors Techniques and Reagents | Knirsch M, et al. (1989) The isolation and reconstitution of the ADP/ATP carrier from wild-type Saccharomyces cerevisiae. Identification of primarily one type (AAC-2). FEBS Lett 244(2):427-32 | |||||
| Alias Function/Process Protein Sequence Features Substrates/Ligands/Cofactors | Mayinger P, et al. (1989) The ADP/ATP carrier from yeast (AAC-2) is uniquely suited for the assignment of the binding center by photoaffinity labeling. FEBS Lett 244(2):421-6 | |||||
| Alias DNA/RNA Sequence Features Fungal Related Genes/Proteins Genetic Interactions Non-Fungal Related Genes/Proteins Protein Sequence Features Strains/Constructs | Lawson JE and Douglas MG (1988) Separate genes encode functionally equivalent ADP/ATP carrier proteins in Saccharomyces cerevisiae. Isolation and analysis of AAC2. J Biol Chem 263(29):14812-8 | |AAC1 | ||||
| Cellular Location Protein Sequence Features | Smagula C and Douglas MG (1988) Mitochondrial import of the ADP/ATP carrier protein in Saccharomyces cerevisiae. Sequences required for receptor binding and membrane translocation. J Biol Chem 263(14):6783-90 | |||||
| Cellular Location DNA/RNA Sequence Features Fungal Related Genes/Proteins Non-Fungal Related Genes/Proteins Protein Physical Properties Protein Sequence Features | Adrian GS, et al. (1986) Sequences required for delivery and localization of the ADP/ATP translocator to the mitochondrial inner membrane. Mol Cell Biol 6(2):626-34 | |||||
| Mapping | Subik J, et al. (1986) Genetic mapping of nuclear mucidin resistance mutations in Saccharomyces cerevisiae. A new pdr locus on chromosome II. Curr Genet 10(9):665-70 | |LYS2 |PDR3 | ||||
| Alias Genetic Interactions Mutants/Phenotypes Strains/Constructs Techniques and Reagents | McEwen JE, et al. (1985) Rapid method for isolation and screening of cytochrome c oxidase-deficient mutants of Saccharomyces cerevisiae. J Bacteriol 161(3):831-5 | |COX6 | ||||
| Alias Cellular Location Genetic Interactions Mutants/Phenotypes Protein Physical Properties Strains/Constructs Techniques and Reagents | O'Malley K, et al. (1982) Selection of the nuclear gene for the mitochondrial adenine nucleotide translocator by genetic complementation of the op1 mutation in yeast. J Biol Chem 257(4):2097-103 | |||||
| Genetic Interactions Mutants/Phenotypes Strains/Constructs | Sigler K, et al. (1981) Factors governing substrate-induced generation and extrusion of protons in the yeast Saccharomyces cerevisiae. Biochim Biophys Acta 643(3):572-82 | |||||
| Alias Mutants/Phenotypes Strains/Constructs | Horak J, et al. (1978) Stimulation of amino acid transport in Saccharomyces cerevisiae by metabolic inhibitors. Folia Microbiol (Praha) 23(4):286-91 | |AGP1 |AGP3 |ALP1 |BAP2 |BAP3 |CAN1 |DIP5 |GNP1 |PMA1 | ||||
| Alias Mutants/Phenotypes Strains/Constructs | Lauquin G, et al. (1976) Effect of genetic and physiological manipulations onthe kinetic and binding parameters of the adenine nucleotide translocator in Saccharomyces cervisiae and Candida utilis. Biochimie 58(10):1213-20 | |||||
| Alias Mutants/Phenotypes Strains/Constructs | Ulaszewski S and Lachowicz TM (1975) Specificity and origin of the Mod2- mutation which restores respiratory sufficient phenotype in some pet mutants in Saccharomyces cerevisiae. Acta Microbiol Pol [A] 7(2):77-85 | |||||
| Alias Function/Process Mutants/Phenotypes Strains/Constructs | Beck JC, et al. (1968) Genetic modification of energy-conserving systems in yeast mitochondria. Proc Natl Acad Sci U S A 60(1):186-93 | |||||
| Function/Process Mutants/Phenotypes Strains/Constructs | Kovacova V, et al. (1968) Oxidative phosphorylatiion in yeast. IV. Combination of a nuclear mutation affecting oxidative phosphorylation with cytoplasmic mutation to respiratory deficiency. Biochim Biophys Acta 162(2):157-63 | |||||
| Alias Function/Process Mutants/Phenotypes Strains/Constructs | Kovac L, et al. (1967) Biochemical genetics of oxidative phosphorylation. Science 158(808):1564-7 | |||||
Return to SGD |