PRM9/YAR031W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrI: 186830 to 187726
CDS: 186830 - 187726

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

PRM9 YAR031W ORF, Verified S000000078

This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community.
Gene name reserved on: 2000-09-05. Gene name expires on 2001-09-05.
Description
Pheromone-regulated protein with 3 predicted transmembrane segments and an FF sequence, a motif involved in COPII binding; member of DUP240 gene family

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
molecular_function
unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD
   ND : No Biological Data Available
Assigned on 2001-01-19 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0813
Assigned on 2007-05-23 UniProtKB
vesicle organization Sandmann T, et al. (2003) Suppression of coatomer mutants by a new protein family with COPI and COPII binding motifs in Saccharomyces cerevisiae. Mol Biol Cell 14(8):3097-113
     IPI : Inferred from Physical Interaction
Assigned on 2004-06-29 SGD
vesicle-mediated transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0931
Assigned on 2008-02-14 UniProtKB
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
endoplasmic reticulum Sandmann T, et al. (2003) Suppression of coatomer mutants by a new protein family with COPI and COPII binding motifs in Saccharomyces cerevisiae. Mol Biol Cell 14(8):3097-113
     IPI : Inferred from Physical Interaction
Assigned on 2003-09-18 SGD
integral to membrane Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30
       ISS : Inferred from Sequence or structural Similarity
Assigned on 2001-01-18 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB
plasma membrane Poirey R, et al. (2002) Functional analysis of the Saccharomyces cerevisiae DUP240 multigene family reveals membrane-associated proteins that are not essential for cell viability. Microbiology 148(Pt 7):2111-23
       IMP : Inferred from Mutant Phenotype
Assigned on 2008-03-10 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-1003
Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forPRM9/YAR031W for PRM9
1) Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30

2) Feuermann M, et al. (1997) The characterization of two new clusters of duplicated genes suggests a 'Lego' organization of the yeast Saccharomyces cerevisiae chromosomes. Yeast 13(9):861-9

3) Sandmann T, et al. (2003) Suppression of coatomer mutants by a new protein family with COPI and COPII binding motifs in Saccharomyces cerevisiae. Mol Biol Cell 14(8):3097-113

4) Poirey R, et al. (2002) Functional analysis of the Saccharomyces cerevisiae DUP240 multigene family reveals membrane-associated proteins that are not essential for cell viability. Microbiology 148(Pt 7):2111-23

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for PRM9/YAR031W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for PRM9/YAR031W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MSPQYHF

C-term PGVDEFF

Length(aa) 298

MW(Da) 35,073

pI 8.08

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias -0.085

Codon Adaptation Index 0.107

Frequency of Optimal Codons 0.369

Hydropathicity of Protein -0.329

Aromaticity Score 0.161

10 20 30 40 50 | | | | | MSPQYHFYFVSFRNLVLNEKCLRSKKQVMKSFNWYKTDRYFDPHNILQHH SRAIEKTRYKLGMQTSSESTDAKSDFLDEPSAYLIEKNVALPKDIFGSYL SYWIYEVTRHKAAVILLVLIVTSILLLVFFYNTEFCVAFEILLFSFCFPG TCMVVIAFSEPIGDREFKVKLLMEIITRKPAVKGKEWRTITYKMNQYLFD HGLWDTPYYFYRDEDCHRYFLSLIKGRTFKKQKESSASNVKDAQSNDETA GTPNEAAESSSFSAGPNFIKLLTKAAEIEQQFQKEYWRQEYPGVDEFF*

Protein Structures from PDB: proteins of known structure with sequence similarity to PRM9/YAR031W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Date Standardized Reference
PRM9 2000-10-30 Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30

Standard Name	Date Standardized	Reference
PRM9	2000-10-30	Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YAR031W SGD Systematic Sequence

851282 NCBI: Gene ID

NP_009418.1 NCBI: RefSeq protein version ID

NP_009418.1 NCBI: RefSeq protein version ID

6319334 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YAR031W	SGD Systematic Sequence
851282	NCBI: Gene ID
NP_009418.1	NCBI: RefSeq protein version ID
NP_009418.1	NCBI: RefSeq protein version ID
6319334	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
11 curated references; 0 references not yet curated
Transcription
Gagneur J, et al. (2009) Genome-wide allele- and strand-specific expression profiling. Mol Syst Biol 5:274
       |DAP2 |FET4 |MST28 |PHO5 |PHO81 |PHO84 |SCS22 |UIP3 |YAR028W |YAR029W |YBR287W
Evolution
Fungal Related Genes/Proteins
Katju V, et al. (2009) Variation in gene duplicates with low synonymous divergence in Saccharomyces cerevisiae relative to Caenorhabditis elegans. Genome Biol 10(7):R75
       |AAD15 |AAD3 |ANB1 |ASP3-1 |ASP3-2 |ASP3-3 |ASP3-4 |BUD5 |COS1 |COS5 |CUP1-1 |CUP1-2 |DOG1 |DOG2 |MORE
Mutants/Phenotypes
Li F, et al. (2008) Thiopurine S-methyltransferase pharmacogenetics: autophagy as a mechanism for variant allozyme degradation. Pharmacogenet Genomics 18(12):1083-94
     |ADY3 |APE3 |ATG10 |ATG12 |ATG3 |ATG5 |ATG7 |ATG8 |BUD14 |CNE1 |CPS1 |CUE1 |ERP1 |ERP2 |MORE
Fungal Related Genes/Proteins
Despons L, et al. (2006) An evolutionary scenario for one of the largest yeast gene families. Trends Genet 22(1):10-5
       |COS1 |COS10 |COS12 |COS2 |COS3 |COS4 |COS5 |COS6 |COS7 |COS8 |COS9 |ECM34 |MST27 |MST28 |MORE
DNA/RNA Sequence Features
Fungal Related Genes/Proteins
Mapping
Leh-Louis V, et al. (2004) Expansion and contraction of the DUP240 multigene family in Saccharomyces cerevisiae populations. Genetics 167(4):1611-9
       |MST27 |MST28 |PRM8 |UIP3 |YAR028W |YAR029W
Cellular Location
Function/Process
Fungal Related Genes/Proteins
Mutants/Phenotypes
Protein Sequence Features
Protein-protein Interactions
Strains/Constructs
Sandmann T, et al. (2003) Suppression of coatomer mutants by a new protein family with COPI and COPII binding motifs in Saccharomyces cerevisiae. Mol Biol Cell 14(8):3097-113
     |COP1 |GEA2 |MST27 |MST28 |PRM8 |SEC21 |SEC23 |SEC24
Cellular Location
DNA/RNA Sequence Features
Fungal Related Genes/Proteins
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Techniques and Reagents
Poirey R, et al. (2002) Functional analysis of the Saccharomyces cerevisiae DUP240 multigene family reveals membrane-associated proteins that are not essential for cell viability. Microbiology 148(Pt 7):2111-23
       |AGP3 |AVT3 |CWH41 |DTR1 |FIR1 |MCH4 |MST27 |MST28 |NIS1 |PAN1 |PRM8 |RGT2 |TPO1 |UIP3 |MORE
Function/Process
Protein Sequence Features
Regulation of
Heiman MG and Walter P (2000) Prm1p, a pheromone-regulated multispanning membrane protein, facilitates plasma membrane fusion during yeast mating. J Cell Biol 151(3):719-30
       |AGA1 |PRM1 |PRM10 |PRM2 |PRM3 |PRM4 |PRM5 |PRM6 |PRM7 |PRM8
Mutants/Phenotypes
Strains/Constructs
Winzeler EA, et al. (1999) Whole genome genetic-typing in yeast using high-density oligonucleotide arrays. Parasitology 118 Suppl:S73-80
       |ARN2 |ASP3-1 |ASP3-2 |ASP3-3 |ASP3-4 |ATS1 |AYT1 |BDS1 |COS6 |COS7 |COS8 |FLO1 |FMP32 |HXT9 |MORE
DNA/RNA Sequence Features
Mapping
Barton AB, et al. (1997) Molecular cloning of chromosome I DNA from Saccharomyces cerevisiae: characterization of the 54 kb right terminal CDC15-FLO1-PHO11 region. Yeast 13(13):1251-63
       |CDC15 |FLO1 |IMD1 |IMD2 |MST28 |PHO11 |PHO12 |SWH1 |UIP3 |YAR023C |YAR028W |YAR029W |YAR047C |YAR060C |MORE
DNA/RNA Sequence Features
Feuermann M, et al. (1997) The characterization of two new clusters of duplicated genes suggests a 'Lego' organization of the yeast Saccharomyces cerevisiae chromosomes. Yeast 13(9):861-9
       |MST28 |PRM8 |RNA15 |RPT6 |UIP3 |YAR028W |YAR029W

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.