---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

NUP60/YAR002W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrI: 152259 to 153878 CDS: 152259 - 153878 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
NUP60	YAR002W		ORF, Verified	S000000063
Description
Subunit of the nuclear pore complex (NPC), functions to anchor Nup2p to the NPC in a process controlled by the nucleoplasmic concentration of Gsp1p-GTP; potential Cdc28p substrate; involved in telomere maintenance

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By structural constituent of nuclear pore Denning D, et al. (2001) The nucleoporin Nup60p functions as a Gsp1p-GTP-sensitive tether for Nup2p at the nuclear pore complex. J Cell Biol 154(5):937-50        TAS : Traceable Author Statement Assigned on 2002-10-01 SGD
Biological Process Annotation(s) Reference(s) Evidence Assigned By RNA export from nucleus Tian W, et al. (2008) Combining guilt-by-association and guilt-by-profiling to predict Saccharomyces cerevisiae gene function. Genome Biol 9 Suppl 1:S7              RCA : Reviewed Computational Analysis Assigned on 2009-09-03 YeastFunc RNA localization Tian W, et al. (2008) Combining guilt-by-association and guilt-by-profiling to predict Saccharomyces cerevisiae gene function. Genome Biol 9 Suppl 1:S7              RCA : Reviewed Computational Analysis Assigned on 2009-09-03 YeastFunc RNA transport Tian W, et al. (2008) Combining guilt-by-association and guilt-by-profiling to predict Saccharomyces cerevisiae gene function. Genome Biol 9 Suppl 1:S7              RCA : Reviewed Computational Analysis Assigned on 2009-09-03 YeastFunc establishment of RNA localization Tian W, et al. (2008) Combining guilt-by-association and guilt-by-profiling to predict Saccharomyces cerevisiae gene function. Genome Biol 9 Suppl 1:S7              RCA : Reviewed Computational Analysis Assigned on 2009-09-03 YeastFunc mRNA export from nucleus Tian W, et al. (2008) Combining guilt-by-association and guilt-by-profiling to predict Saccharomyces cerevisiae gene function. Genome Biol 9 Suppl 1:S7              RCA : Reviewed Computational Analysis Assigned on 2009-09-03 YeastFunc mRNA transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0509 Assigned on 2007-05-23 UniProtKB Tian W, et al. (2008) Combining guilt-by-association and guilt-by-profiling to predict Saccharomyces cerevisiae gene function. Genome Biol 9 Suppl 1:S7              RCA : Reviewed Computational Analysis Assigned on 2009-09-03 YeastFunc nuclear export Tian W, et al. (2008) Combining guilt-by-association and guilt-by-profiling to predict Saccharomyces cerevisiae gene function. Genome Biol 9 Suppl 1:S7              RCA : Reviewed Computational Analysis Assigned on 2009-09-03 YeastFunc nucleic acid transport Tian W, et al. (2008) Combining guilt-by-association and guilt-by-profiling to predict Saccharomyces cerevisiae gene function. Genome Biol 9 Suppl 1:S7              RCA : Reviewed Computational Analysis Assigned on 2009-09-03 YeastFunc nucleocytoplasmic transport Denning D, et al. (2001) The nucleoporin Nup60p functions as a Gsp1p-GTP-sensitive tether for Nup2p at the nuclear pore complex. J Cell Biol 154(5):937-50        IMP : Inferred from Mutant Phenotype Assigned on 2002-10-01 SGD nucleus organization Tian W, et al. (2008) Combining guilt-by-association and guilt-by-profiling to predict Saccharomyces cerevisiae gene function. Genome Biol 9 Suppl 1:S7              RCA : Reviewed Computational Analysis Assigned on 2009-09-03 YeastFunc protein export from nucleus Tian W, et al. (2008) Combining guilt-by-association and guilt-by-profiling to predict Saccharomyces cerevisiae gene function. Genome Biol 9 Suppl 1:S7              RCA : Reviewed Computational Analysis Assigned on 2009-09-03 YeastFunc protein import into nucleus, docking Denning D, et al. (2001) The nucleoporin Nup60p functions as a Gsp1p-GTP-sensitive tether for Nup2p at the nuclear pore complex. J Cell Biol 154(5):937-50        IPI : Inferred from Physical Interaction IMP : Inferred from Mutant Phenotype Assigned on 2002-10-01 SGD protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0653 Assigned on 2007-05-23 UniProtKB transmembrane transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0811 Assigned on 2009-10-01 UniProtKB transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2008-06-16 UniProtKB nuclear pore Vasu SK and Forbes DJ (2001) Nuclear pores and nuclear assembly. Curr Opin Cell Biol 13(3):363-75        TAS : Traceable Author Statement Assigned on 2002-03-13 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0906 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-0185 Assigned on 2009-05-06 UniProtKB nucleus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0539 Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forNUP60/YAR002W for NUP60 1) Denning D, et al. (2001) The nucleoporin Nup60p functions as a Gsp1p-GTP-sensitive tether for Nup2p at the nuclear pore complex. J Cell Biol 154(5):937-50        2) Ubersax JA, et al. (2003) Targets of the cyclin-dependent kinase Cdk1. Nature 425(6960):859-64          3) Askree SH, et al. (2004) A genome-wide screen for Saccharomyces cerevisiae deletion mutants that affect telomere length. Proc Natl Acad Sci U S A 101(23):8658-63

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for NUP60/YAR002W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for NUP60/YAR002W

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MHRKSLR C-term FKSLYTF Length(aa) 539 MW(Da) 59,039 pI 10.16 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.067   Codon Adaptation Index 0.143   Frequency of Optimal Codons 0.447   Hydropathicity of Protein -0.833   Aromaticity Score 0.071

10 20 30 40 50 | | | | | MHRKSLRRASATVPSAPYRKQIISNAHNKPSLFSKIKTFFTQKDSARVSP RNNVANKQPRNESFNRRISSMPGGYFHSEISPDSTVNRSVVVSAVGEARN DIENKEEEYDETHETNISNAKLANFFSKKGNEPLSEIEIEGVMSLLQKSS KSMITSEGEQKSAEGNNIDQSLILKESGSTPISISNAPTFNPKYDTSNAS MNTTLGSIGSRKYSFNYSSLPSPYKTTVYRYSAAKKIPDTYTANTSAQSI ASAKSVRSGVSKSAPSKKISNTAAALVSLLDENDSKKNNAASELANPYSS YVSQIRKHKRVSPNAAPRQEISEEETTVKPLFQNVPEQGEEPMKQLNATK ISPSAPSKDSFTKYKPARSSSLRSNVVVAETSPEKKDGGDKPPSSAFNFS FNTSRNVEPTENAYKSENAPSASSKEFNFTNLQAKPLVGKPKTELTKGDS TPVQPDLSVTPQKSSSKGFVFNSVQKKSRSNLSQENDNEGKHISASIDND FSEEKAEEFDFNVPVVSKQLGNGLVDENKVEAFKSLYTF*

Protein Structures from PDB: proteins of known structure with sequence similarity to NUP60/YAR002W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
NUP60	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YAR002W	SGD Systematic Sequence
851263	NCBI: Gene ID
NP_009401.1	NCBI: RefSeq protein version ID
NP_009401.1	NCBI: RefSeq protein version ID
6319318	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) Organelle DB (UMich) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
Protein Details Topic Research Highlight Reference Contributor Protein Modification Description: Identified as an efficient substrate of Clb2-Cdk1-as1 in a screen of a proteomic GST-fusion library. Modification Type: Phosphorylation Ubersax JA, et al. (2003) Targets of the cyclin-dependent kinase Cdk1. Nature 425(6960):859-64          Jeff Ubersax 2004-01-21

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
54 curated references; 0 references not yet curated
Function/Process Mutants/Phenotypes Strains/Constructs	Ahmed S, et al. (2010) DNA zip codes control an ancient mechanism for gene targeting to the nuclear periphery. Nat Cell Biol 12(2):111-8	|GLE2 |INO1 |MLP2 |NUP1 |NUP157 |NUP2 |SAC3 |SUS1 |THP1 |TSA2
Reviews	Fiserova J and Goldberg MW (2010) Nucleocytoplasmic transport in yeast: a few roles for many actors. Biochem Soc Trans 38(Pt 1):273-7	|KAP104 |KAP114 |KAP123 |KAP95 |MEX67 |MSN5 |NIC96 |NMD5 |NUP1 |NUP100 |NUP116 |NUP133 |NUP145 |NUP159 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	He X, et al. (2010) Prevalent positive epistasis in Escherichia coli and Saccharomyces cerevisiae metabolic networks. Nat Genet	|ACT1 |ALG7 |AVO1 |CCT2 |CHO2 |EOS1 |GAA1 |GAS1 |GUK1 |MET22 |NUS1 |RPC10 |RPL14A |RPS5 |MORE
Reviews	Davidson MB and Brown GW (2009) Dissecting the DNA damage response using functional genomics approaches in S. cerevisiae. DNA Repair (Amst) 8(9):1110-7	|ASF1 |CDC34 |CSM3 |CTF13 |CTF18 |CTF4 |CTF8 |DCC1 |DDC1 |DIA2 |DNA2 |DUN1 |ELG1 |LCD1 |MORE
Cellular Location Regulation of	Makio T, et al. (2009) The nucleoporins Nup170p and Nup157p are essential for nuclear pore complex assembly. J Cell Biol 185(3):459-73	|APQ12 |ASM4 |GLE1 |KAP104 |KAP123 |KAP95 |MLP1 |NAB2 |NDC1 |NUP1 |NUP100 |NUP133 |NUP157 |NUP159 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Scott RJ, et al. (2009) The nuclear export factor Xpo1p targets Mad1p to kinetochores in yeast. J Cell Biol 184(1):21-9	|BUB1 |CBF2 |CDC26 |CRM1 |GSP1 |KAP95 |MAD1 |MSN5 |MTW1 |SRM1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Skruzny M, et al. (2009) An endoribonuclease functionally linked to perinuclear mRNP quality control associates with the nuclear pore complexes. PLoS Biol 7(1):e8	|ESC1 |HPR1 |MFT1 |MLP1 |NPL3 |NUP133 |SAC3 |SSA1 |SUB2 |SUS1 |SWT1 |THO2 |THP1 |THP2
Mutants/Phenotypes	Xiong L, et al. (2009) Deficient SUMO attachment to Flp recombinase leads to homologous recombination-dependent hyperamplification of the yeast 2 microm circle plasmid. Mol Biol Cell 20(4):1241-51	|FLP1 |NFI1 |RAD52 |SIZ1 |SLX5 |SLX8 |TOP1
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Gonzalez-Aguilera C, et al. (2008) The THP1-SAC3-SUS1-CDC31 complex works in transcription elongation-mRNA export preventing RNA-mediated genome instability. Mol Biol Cell 19(10):4310-8	|DBP5 |GLE1 |HPR1 |MEX67 |MTR4 |NAB2 |NUP120 |NUP133 |NUP84 |PAP1 |RAT1 |RRP6 |SAC3 |SUB2 |MORE
Strains/Constructs	Harper NC, et al. (2008) Mutations affecting spindle pole body and mitotic exit network function are synthetically lethal with a deletion of the nucleoporin NUP1 in S. cerevisiae. Curr Genet 53(2):95-105	|BFA1 |BUB2 |DBF2 |LTE1 |NIC96 |NSP1 |NUD1 |NUP1 |NUP170 |SWI5
Genetic Interactions Strains/Constructs	Nagai S, et al. (2008) Functional targeting of DNA damage to a nuclear pore-associated SUMO-dependent ubiquitin ligase. Science 322(5901):597-602	|ARS607 |MEC1 |NUP120 |NUP133 |NUP49 |NUP84 |SLX5 |SLX8
Substrates/Ligands/Cofactors	Patel SS and Rexach MF (2008) Discovering novel interactions at the nuclear pore complex using bead halo: a rapid method for detecting molecular interactions of high and low affinity at equilibrium. Mol Cell Proteomics 7(1):121-31	|ASM4 |GLE1 |KAP95 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP53 |NUP84 |POM34 |SEH1 |SRM1 |MORE
Protein-protein Interactions	Rougemaille M, et al. (2008) THO/Sub2p functions to coordinate 3'-end processing with gene-nuclear pore association. Cell 135(2):308-21	|GLE1 |HPR1 |HSP104 |MEX67 |MFT1 |NUP116 |PAP1 |PCF11 |RNA14 |RNA15 |SUB2 |THO2
Mutants/Phenotypes	Thomsen R, et al. (2008) General, rapid, and transcription-dependent fragmentation of nucleolar antigens in S. cerevisiae mRNA export mutants. RNA 14(4):706-16	|ASM4 |HPR1 |HSP104 |MEX67 |MFT1 |NOP1 |NOP58 |NSR1 |NUP100 |NUP120 |NUP133 |NUP159 |NUP188 |NUP2 |MORE
Genetic Interactions Strains/Constructs	Wilmes GM, et al. (2008) A genetic interaction map of RNA-processing factors reveals links between Sem1/Dss1-containing complexes and mRNA export and splicing. Mol Cell 32(5):735-46	|APQ12 |BRR1 |CAK1 |CBC2 |CHD1 |CSN12 |CSN9 |DBP5 |GIM4 |IST3 |ISY1 |LRP1 |MEX67 |MUD2 |MORE
Reviews	Ahmed S and Brickner JH (2007) Regulation and epigenetic control of transcription at the nuclear periphery. Trends Genet 23(8):396-402	|ADA2 |CHD1 |GCN5 |HFI1 |HTZ1 |MEX67 |MLP1 |MLP2 |NGG1 |NUP2 |NUP84 |SAC3 |SGF11 |SGF29 |MORE
Cellular Location Computational analysis Protein Physical Properties Protein-protein Interactions Protein/Nucleic Acid Structure	Alber F, et al. (2007) Determining the architectures of macromolecular assemblies. Nature 450(7170):683-94	|ASM4 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |MORE
Cellular Location Evolution Protein/Nucleic Acid Structure	Alber F, et al. (2007) The molecular architecture of the nuclear pore complex. Nature 450(7170):695-701	|ASM4 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Alvaro D, et al. (2007) Genome-wide analysis of Rad52 foci reveals diverse mechanisms impacting recombination. PLoS Genet 3(12):e228	|AHC1 |ATR1 |BCK1 |BDF1 |BDF2 |BUB2 |BUD27 |CBT1 |COX16 |CTF19 |CTF4 |DAK2 |DDC1 |DDR2 |MORE
Protein Sequence Features	Chang EJ, et al. (2007) Prediction of cyclin-dependent kinase phosphorylation substrates. PLoS One 2(7):e656	|ACC1 |ACE2 |ACM1 |ADY3 |AFI1 |ALY2 |ASE1 |ASH1 |BCK1 |BEM3 |BNI1 |BNI4 |BOI1 |BUD3 |MORE
Function/Process Genetic Interactions	Chen XL, et al. (2007) Topoisomerase I-Dependent Viability Loss in Saccharomyces cerevisiae Mutants Defective in Both SUMO Conjugation and DNA Repair. Genetics 177(1):17-30	|MRE11 |NFI1 |NUP133 |RAD27 |RAD50 |RAD51 |RAD52 |RAD54 |RAD55 |RAD57 |SIZ1 |TOP1 |TRI1 |ULP1 |MORE
Evolution Fungal Related Genes/Proteins Protein Sequence Features Protein/Nucleic Acid Structure	Denning DP and Rexach MF (2007) Rapid evolution exposes the boundaries of domain structure and function in natively unfolded FG nucleoporins. Mol Cell Proteomics 6(2):272-82	|ASM4 |NSP1 |NUP1 |NUP100 |NUP116 |NUP159 |NUP2 |NUP42 |NUP49 |NUP53 |NUP57
Mutants/Phenotypes Strains/Constructs	Huang RY, et al. (2007) Small ubiquitin-related modifier pathway is a major determinant of doxorubicin cytotoxicity in Saccharomyces cerevisiae. Cancer Res 67(2):765-72	|CDC11 |CDC3 |MLP1 |MMS21 |NFI1 |POL30 |RAD52 |RAD6 |SHS1 |SIZ1 |UBA2 |UBC9 |UIP3 |ULP1 |MORE
Reviews	Kohler A and Hurt E (2007) Exporting RNA from the nucleus to the cytoplasm. Nat Rev Mol Cell Biol 8(10):761-73	|ARC1 |ARX1 |CDC31 |CEX1 |CRM1 |DBP5 |GLE1 |GLE2 |HTZ1 |LOS1 |MEX67 |MLP1 |MLP2 |MTR2 |MORE
Cellular Location Genetic Interactions Strains/Constructs	Lewis A, et al. (2007) A nuclear envelope protein linking nuclear pore basket assembly, SUMO protease regulation, and mRNA surveillance. J Cell Biol 178(5):813-27	|ESC1 |ESC2 |MLP1 |MLP2 |NUP2 |NUP49 |SIR4 |ULP1 |ULP2 |YKU80
Protein-protein Interactions Techniques and Reagents	Oeffinger M, et al. (2007) Comprehensive analysis of diverse ribonucleoprotein complexes. Nat Methods 4(11):951-6	|ACB1 |ACT1 |ADE3 |AIM34 |ASH1 |ASM4 |BEM2 |BRR2 |BRX1 |BUD8 |CBC2 |CBF5 |CDC3 |CDC31 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Regulatory Role Strains/Constructs	Palancade B, et al. (2007) Nucleoporins prevent DNA damage accumulation by modulating Ulp1-dependent sumoylation processes. Mol Biol Cell 18(8):2912-23	|MRE11 |NUP120 |NUP133 |RAD27 |RAD50 |RAD51 |RAD52 |RAD54 |RAD55 |SLX5 |SLX8 |SRS2 |ULP1 |YKU70
Cellular Location Function/Process Protein Sequence Features Protein-protein Interactions	Patel SS, et al. (2007) Natively unfolded nucleoporins gate protein diffusion across the nuclear pore complex. Cell 129(1):83-96	|GLE1 |GLE2 |KAP95 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP157 |NUP159 |NUP170 |NUP192 |MORE
Protein Processing/Modification/Regulation Regulation of	Smolka MB, et al. (2007) Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. Proc Natl Acad Sci U S A 104(25):10364-9	|CEP3 |CPR5 |CTF4 |DEF1 |DUN1 |EXO1 |HPC2 |ITC1 |MEC1 |MLP1 |NET1 |NPL3 |NSP1 |NUP1 |MORE
Reviews	Taddei A (2007) Active genes at the nuclear pore complex. Curr Opin Cell Biol 19(3):305-310	|ASM4 |CDC31 |DBP5 |GAL1 |GFD1 |GLE1 |GLE2 |HSP104 |HTZ1 |INO1 |KAP120 |KAP122 |KAP123 |KAP95 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Terry LJ and Wente SR (2007) Nuclear mRNA export requires specific FG nucleoporins for translocation through the nuclear pore complex. J Cell Biol 178(7):1121-32	|KAP104 |MEX67 |NSP1 |NUP1 |NUP100 |NUP116 |NUP145 |NUP2 |NUP49 |NUP57 |PSE1
Evolution Fungal Related Genes/Proteins	De Hertogh B, et al. (2006) Emergence of species-specific transporters during evolution of the hemiascomycete phylum. Genetics 172(2):771-81	|AAC1 |AAC3 |ACS2 |ADP1 |ADY2 |AGC1 |AGP1 |AGP2 |AGP3 |ALP1 |ALR1 |ALR2 |ANT1 |AQR1 |MORE
Computational analysis Non-Fungal Related Genes/Proteins Protein Sequence Features Protein/Nucleic Acid Structure Strains/Constructs	Devos D, et al. (2006) Simple fold composition and modular architecture of the nuclear pore complex. Proc Natl Acad Sci U S A 103(7):2172-7	|ASM4 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |NUP159 |NUP170 |NUP188 |MORE
Mutants/Phenotypes Techniques and Reagents	Freimoser FM, et al. (2006) Systematic screening of polyphosphate (poly P) levels in yeast mutant cells reveals strong interdependence with primary metabolism. Genome Biol 7(11):R109	|ADE1 |ADE3 |AKR1 |ALT2 |APL5 |APL6 |APM3 |APS3 |ARO1 |ARP5 |ATG12 |ATG20 |ATP15 |AVT6 |MORE
Cellular Location Protein Processing/Modification/Regulation Regulation of	Madrid AS, et al. (2006) The role of the integral membrane nucleoporins Ndc1p and Pom152p in nuclear pore complex assembly and function. J Cell Biol 173(3):361-71	|ASM4 |NDC1 |NPL3 |NUP159 |POM152 |POM34
Reviews	Santangelo GM (2006) Glucose signaling in Saccharomyces cerevisiae. Microbiol Mol Biol Rev 70(1):253-82	|ASM4 |BCY1 |CDC25 |CDC53 |CTI6 |CYC3 |CYR1 |ESC1 |GAL1 |GAL10 |GAL4 |GAL7 |GAL83 |GCR1 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Dilworth DJ, et al. (2005) The mobile nucleoporin Nup2p and chromatin-bound Prp20p function in endogenous NPC-mediated transcriptional control. J Cell Biol 171(6):955-65	|HTZ1 |NUP2 |SRM1
Protein Processing/Modification/Regulation	Gruhler A, et al. (2005) Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway. Mol Cell Proteomics 4(3):310-27	|ADR1 |AFR1 |AHP1 |BEM3 |BOI2 |BUD4 |CDC15 |CDC19 |CDC28 |CHD1 |COG3 |CRP1 |CUE2 |CYR1 |MORE
Mutants/Phenotypes	Luna R, et al. (2005) Interdependence between transcription and mRNP processing and export, and its impact on genetic stability. Mol Cell 18(6):711-22	|BRR6 |CAF20 |CCR4 |CDC40 |CFT1 |CRM1 |DBP1 |DBP5 |DBP7 |DCP1 |FIP1 |GBP2 |GLE1 |HRB1 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Palancade B, et al. (2005) Pml39, a novel protein of the nuclear periphery required for nuclear retention of improper messenger ribonucleoparticles. Mol Biol Cell 16(11):5258-68	|MLP1 |MLP2 |NAB2 |NUP120 |NUP133 |NUP157 |PML1 |PML39 |RRP6 |YRA1
Mutants/Phenotypes Strains/Constructs	Scott RJ, et al. (2005) Interactions between Mad1p and the nuclear transport machinery in the yeast Saccharomyces cerevisiae. Mol Biol Cell 16(9):4362-74	|KAP95 |MAD1 |MLP1 |MLP2 |NUP170 |NUP2 |NUP53 |POM34 |PSE1
Mutants/Phenotypes Strains/Constructs	Askree SH, et al. (2004) A genome-wide screen for Saccharomyces cerevisiae deletion mutants that affect telomere length. Proc Natl Acad Sci U S A 101(23):8658-63	|ADE12 |ADO1 |AGP2 |APE3 |ARG2 |ARV1 |ASC1 |ATG11 |BEM4 |BRE2 |BRO1 |BUD16 |BUD30 |CAX4 |MORE
Genetic Interactions Strains/Constructs	Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13	|AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Cellular Location Genetic Interactions Mutants/Phenotypes Strains/Constructs	Zhao X, et al. (2004) Mlp-dependent anchorage and stabilization of a desumoylating enzyme is required to prevent clonal lethality. J Cell Biol 167(4):605-11	|MLP1 |MLP2 |ULP1
Protein Physical Properties Protein Sequence Features	Denning DP, et al. (2003) Disorder in the nuclear pore complex: the FG repeat regions of nucleoporins are natively unfolded. Proc Natl Acad Sci U S A 100(5):2450-5	|ASM4 |CDC31 |GLE1 |GLE2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |NUP145 |NUP157 |MORE
Protein Processing/Modification/Regulation Regulation of	Ubersax JA, et al. (2003) Targets of the cyclin-dependent kinase Cdk1. Nature 425(6960):859-64	|ACE2 |ACF4 |ACM1 |ADY3 |ALY2 |ARG1 |ASE1 |ASH1 |ATG20 |AXL2 |BBP1 |BCK2 |BEM1 |BEM3 |MORE
Cellular Location Function/Process Mutants/Phenotypes Strains/Constructs	Feuerbach F, et al. (2002) Nuclear architecture and spatial positioning help establish transcriptional states of telomeres in yeast. Nat Cell Biol 4(3):214-21	|MLP1 |MLP2 |NUP145
Function/Process Protein-protein Interactions Techniques and Reagents	Allen NP, et al. (2001) Proteomic analysis of nucleoporin interacting proteins. J Biol Chem 276(31):29268-74	|GSP1 |KAP95 |NUP1 |NUP100 |NUP116 |NUP2 |NUP42 |NUP49 |NUP57 |NUP84 |SRP1
Cellular Location Function/Process Mutants/Phenotypes Protein-protein Interactions Regulatory Role Strains/Constructs Techniques and Reagents	Denning D, et al. (2001) The nucleoporin Nup60p functions as a Gsp1p-GTP-sensitive tether for Nup2p at the nuclear pore complex. J Cell Biol 154(5):937-50	|GSP1 |KAP123 |KAP95 |NUP1 |NUP2 |SRM1 |SRP1
Function/Process Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Dilworth DJ, et al. (2001) Nup2p dynamically associates with the distal regions of the yeast nuclear pore complex. J Cell Biol 153(7):1465-78	|NUP2 |SRP1
Reviews	Vasu SK and Forbes DJ (2001) Nuclear pores and nuclear assembly. Curr Opin Cell Biol 13(3):363-75	|ASM4 |CDC31 |GLE1 |GLE2 |MLP1 |MLP2 |NDC1 |NIC96 |NSP1 |NUP1 |NUP100 |NUP116 |NUP120 |NUP133 |MORE
Cellular Location Protein Physical Properties Protein-protein Interactions Strains/Constructs Techniques and Reagents	Rout MP, et al. (2000) The yeast nuclear pore complex: composition, architecture, and transport mechanism. J Cell Biol 148(4):635-51	|AIM4 |ASM4 |BMS1 |BUD20 |CTR9 |GLE1 |GLE2 |HAS1 |KAP120 |KAP122 |KAP123 |KAP95 |KRR1 |MEX67 |MORE
Reviews	Pante N and Aebi U (1996) Molecular dissection of the nuclear pore complex. Crit Rev Biochem Mol Biol 31(2):153-99	|ASM4 |NSP1 |NUP1 |NUP100 |NUP116 |NUP133 |NUP157 |NUP159 |NUP170 |NUP188 |NUP2 |NUP49 |POM152 |POM34
Reviews	Davis LI (1995) The nuclear pore complex. Annu Rev Biochem 64:865-96	|ASM4 |NSP1 |NUP1 |NUP100 |NUP116 |NUP133 |NUP157 |NUP159 |NUP170 |NUP188 |NUP2 |NUP49 |POM152 |POM34

Return to SGD

Send a Message to the SGD Curators