CNE1/YAL058W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrI: 37465 to 38973
CDS: 37465 - 38973

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

CNE1 YAL058W FUN48 ORF, Verified S000000054

Description
Calnexin; integral membrane ER chaperone involved in folding and quality control of glycoproteins; chaperone activity is inhibited by Mpd1p, with which Cne1p interacts; 24% identical to mammalian calnexin; Ca+ binding not yet shown in yeast

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
calcium ion binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR001580 , EBI:IPR009033 , EBI:IPR018124
Assigned on 2007-05-23 UniProtKB
sugar binding GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0430
Assigned on 2007-05-23 UniProtKB
unfolded protein binding Parlati F, et al. (1995) Saccharomyces cerevisiae CNE1 encodes an endoplasmic reticulum (ER) membrane protein with sequence similarity to calnexin and calreticulin and functions as a constituent of the ER quality control apparatus. J Biol Chem 270(1):244-53
       ISS : Inferred from Sequence or structural Similarity
Assigned on 2005-05-03 SGD
Xu X, et al. (2004) Expression and characterization of Saccharomyces cerevisiae Cne1p, a calnexin homologue. J Biochem 135(5):615-8
       IMP : Inferred from Mutant Phenotype
Assigned on 2005-05-03 SGD
DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR009033
Assigned on 2008-02-13 UniProtKB
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
ER-associated protein catabolic process Parlati F, et al. (1995) Saccharomyces cerevisiae CNE1 encodes an endoplasmic reticulum (ER) membrane protein with sequence similarity to calnexin and calreticulin and functions as a constituent of the ER quality control apparatus. J Biol Chem 270(1):244-53
       IMP : Inferred from Mutant Phenotype
Assigned on 2002-07-17 SGD
protein folding Xu X, et al. (2004) Expression and characterization of Saccharomyces cerevisiae Cne1p, a calnexin homologue. J Biochem 135(5):615-8
       IMP : Inferred from Mutant Phenotype
Assigned on 2005-05-03 SGD
DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR009033
Assigned on 2008-02-13 UniProtKB
translational elongation Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets
   RCA : Reviewed Computational Analysis
Assigned on 2009-08-06 bioPIXIE_MEFIT
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
endoplasmic reticulum DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.
     IEA : Inferred from Electronic Annotation with EBI:IPR009033
Assigned on 2008-02-13 UniProtKB
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23 UniProtKB
integral to endoplasmic reticulum membrane Parlati F, et al. (1995) Saccharomyces cerevisiae CNE1 encodes an endoplasmic reticulum (ER) membrane protein with sequence similarity to calnexin and calreticulin and functions as a constituent of the ER quality control apparatus. J Biol Chem 270(1):244-53
       IDA : Inferred from Direct Assay
Assigned on 2002-07-17 SGD
integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9905
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forCNE1/YAL058W for CNE1
1) Parlati F, et al. (1995) Saccharomyces cerevisiae CNE1 encodes an endoplasmic reticulum (ER) membrane protein with sequence similarity to calnexin and calreticulin and functions as a constituent of the ER quality control apparatus. J Biol Chem 270(1):244-53

2) Xu X, et al. (2004) Expression and characterization of Saccharomyces cerevisiae Cne1p, a calnexin homologue. J Biochem 135(5):615-8

3) Xu X, et al. (2004) P-domain and lectin site are involved in the chaperone function of Saccharomyces cerevisiae calnexin homologue. FEBS Lett 570(1-3):155-60

4) Kimura T, et al. (2005) Interactions among Yeast Protein-Disulfide Isomerase Proteins and Endoplasmic Reticulum Chaperone Proteins Influence Their Activities. J Biol Chem 280(36):31438-41

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for CNE1/YAL058W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for CNE1/YAL058W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MKFSAYL

C-term LCCVVFT

Length(aa) 502

MW(Da) 56,967

pI 5.04

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.028

Codon Adaptation Index 0.109

Frequency of Optimal Codons 0.425

Hydropathicity of Protein -0.345

Aromaticity Score 0.090

10 20 30 40 50 | | | | | MKFSAYLWWLFLNLALVKGTSLLSNVTLAEDSFWEHFQAYTNTKHLNQEW ITSEAVNNEGSKIYGAQWRLSQGRLQGSAWDKGIAVRTGNAAAMIGHLLE TPINVSETDTLVVQYEIKLDNSLTCGGAFIKLMSGFMNVEALKHYAPDTE GVELVFGPDYCAPEINGVQFAINKVDKITHESKLRYLQEMPLSKLTDTSQ SHLYTLIIDESAQSFQILIDGKTVMVREHIEDKKKVNFEPPITPPLMIPD VSVAKPHDWDDRIRIPDPEAVKLSDRDERDPLMIPHPDGTEPPEWNSSIP EYILDPNAQKPSWWKELEHGEWIPPMIKNPLCTAERGCGQQIPGLINNAK YKGPGELNEIINPNYMGEWHPPEIENPLYYEEQHPLRIENVISGVILEFW SGSPNMLISNIYVGKNVTEAQIIGNKTWLMRDRAFRGSDGPTERKFMNSR LGNLQTTFHNERESPNPFDRIIDRILEQPLKFVLTAAVVLLTTSVLCCVV FT*

Protein Structures from PDB: proteins of known structure with sequence similarity to CNE1/YAL058W, based on Smith-Waterman analysis. [TOP] [NEXT]
PDB protein structure(s) homologous to CNE1 Homolog Source (per PDB) Protein Alignment: CNE1 vs. Homolog External Links
P-Value %Identical %Similar Alignment
1jhn ( Chain: A)
Crystal structure of the lumenal domain of calnexin
PDB_Info
PDB_Structure
Canis lupus familiaris 7.4e-44 33 29 View alignment SCOP
MMDB
CATH
1hhn ( Chain: A)
Calreticulin p-domain
PDB_Info
PDB_Structure
Rattus norvegicus 1.6e-11 40 15 View alignment SCOP
MMDB
CATH
1k9c ( Chain: A)
Solution structure of calreticulin p-domain subdomain (residues 189-261)
PDB_Info
PDB_Structure
Rattus norvegicus 8.5e-08 46 20 View alignment SCOP
MMDB
CATH
1k91 ( Chain: A)
Solution structure of calreticulin p-domain subdomain (residues 221-256)
PDB_Info
PDB_Structure
Rattus norvegicus 0.002600 58 16 View alignment SCOP
MMDB
CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
CNE1 SGD (2007) Information without a citation in SGD

Standard Name	Reference
CNE1	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YAL058W SGD Systematic Sequence

851241 NCBI: Gene ID

NP_009343.1 NCBI: RefSeq protein version ID

NP_009343.1 NCBI: RefSeq protein version ID

6319260 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YAL058W	SGD Systematic Sequence
851241	NCBI: Gene ID
NP_009343.1	NCBI: RefSeq protein version ID
NP_009343.1	NCBI: RefSeq protein version ID
6319260	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
25 curated references; 0 references not yet curated
Cellular Location
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Madeo F, et al. (2009) Phylogenetic conservation of the preapoptotic calreticulin exposure pathway from yeast to mammals. Cell Cycle 8(4):639-42
       |GCN2 |IRE1 |MCA1 |NYV1 |SSO1 |YET3
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Li F, et al. (2008) Thiopurine S-methyltransferase pharmacogenetics: autophagy as a mechanism for variant allozyme degradation. Pharmacogenet Genomics 18(12):1083-94
     |ADY3 |APE3 |ATG10 |ATG12 |ATG3 |ATG5 |ATG7 |ATG8 |BUD14 |CPS1 |CUE1 |ERP1 |ERP2 |ERV46 |MORE
Mutants/Phenotypes
Regulatory Role
Strains/Constructs
Zhang H, et al. (2008) The effect of calnexin deletion on the expression level of PDI in Saccharomyces cerevisiae under heat stress conditions. Cell Mol Biol Lett 13(1):38-48
       |PDI1
Alias
Mutants/Phenotypes
Strains/Constructs
Zhang H, et al. (2008) The effect of calnexin deletion on the expression level of binding protein (BiP) under heat stress conditions in Saccharomyces cerevisiae. Cell Mol Biol Lett 13(4):621-31
       |KAR2
Reviews
Lesage G and Bussey H (2006) Cell wall assembly in Saccharomyces cerevisiae. Microbiol Mol Biol Rev 70(2):317-43
       |ANP1 |BGL2 |BIG1 |CDA1 |CDA2 |CHS1 |CHS2 |CHS3 |CHS6 |CHS7 |CRH1 |CRR1 |CTS1 |CTS2 |MORE
Genetic Interactions
Strains/Constructs
Subramanian S, et al. (2006) Pbn1p: an essential endoplasmic reticulum membrane protein required for protein processing in the endoplasmic reticulum of budding yeast. Proc Natl Acad Sci U S A 103(4):939-44
       |ERO1 |GAS1 |PBN1 |PHO8 |PRB1
Genetic Interactions
Takeuchi M, et al. (2006) Saccharomyces cerevisiae Rot1p is an ER-localized membrane protein that may function with BiP/Kar2p in protein folding. J Biochem 139(3):597-605
         |KAR2 |LHS1 |ROT1 |SCJ1
Protein-protein Interactions
Protein/Nucleic Acid Structure
Kimura T, et al. (2005) Interactions among Yeast Protein-Disulfide Isomerase Proteins and Endoplasmic Reticulum Chaperone Proteins Influence Their Activities. J Biol Chem 280(36):31438-41
       |EPS1 |EUG1 |KAR2 |MPD1 |MPD2 |PDI1
Function/Process
Mutants/Phenotypes
Strains/Constructs
Kostova Z and Wolf DH (2005) Importance of carbohydrate positioning in the recognition of mutated CPY for ER-associated degradation. J Cell Sci 118(Pt 7):1485-92
       |MNL1 |PRC1
RNA Levels and Processing
Regulation of
Mendelsohn RD, et al. (2005) A hypomorphic allele of the first N-glycosylation gene, ALG7, causes mitochondrial defects in yeast. Biochim Biophys Acta 1723(1-3):33-44
       |ALG3 |ALG5 |ALG6 |ALG7 |CHS1 |GPX2 |GSC2 |KAR2 |URA3 |YBR241C |YBR242W
Function/Process
Genetic Interactions
Schuldiner M, et al. (2005) Exploration of the function and organization of the yeast early secretory pathway through an epistatic miniarray profile. Cell 123(3):507-19
           |ALG12 |ALG3 |ALG5 |ALG6 |ALG8 |ALG9 |API2 |APL5 |APL6 |APM3 |APS3 |ARL1 |ARL3 |ARV1 |MORE
Genetic Interactions
Strains/Constructs
Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13
           |AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Function/Process
Mutants/Phenotypes
Strains/Constructs
Xu X, et al. (2004) Expression and characterization of Saccharomyces cerevisiae Cne1p, a calnexin homologue. J Biochem 135(5):615-8

Function/Process
Mutants/Phenotypes
Protein Sequence Features
Strains/Constructs
Xu X, et al. (2004) P-domain and lectin site are involved in the chaperone function of Saccharomyces cerevisiae calnexin homologue. FEBS Lett 570(1-3):155-60

Function/Process
Mutants/Phenotypes
Strains/Constructs
Prinz B, et al. (2003) Intracellular transport of a heterologous membrane protein, the human transferrin receptor, in Saccharomyces cerevisiae. Int Microbiol 6(1):49-55

Function/Process
Mutants/Phenotypes
Strains/Constructs
Song Y, et al. (2002) Different effects of calnexin deletion in Saccharomyces cerevisiae on the secretion of two glycosylated amyloidogenic lysozymes. FEBS Lett 512(1-3):213-7
       |KAR2 |PDI1
Function/Process
Mutants/Phenotypes
Strains/Constructs
Song Y, et al. (2001) Effects of calnexin deletion in Saccharomyces cerevisiae on the secretion of glycosylated lysozymes. J Biochem 130(6):757-64
       |KAR2 |PDI1
Function/Process
Other Features
Eisfeld K, et al. (2000) Endocytotic uptake and retrograde transport of a virally encoded killer toxin in yeast. Mol Microbiol 37(4):926-40
       |END3 |ERD1 |ERD2 |KAR2 |KEX1 |SEC61 |SLA2
Function/Process
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Brodsky JL, et al. (1999) The requirement for molecular chaperones during endoplasmic reticulum-associated protein degradation demonstrates that protein export and import are mechanistically distinct. J Biol Chem 274(6):3453-60
       |KAR2 |SEC61 |SSA1
Function/Process
Genetic Interactions
Mutants/Phenotypes
Shahinian S, et al. (1998) Involvement of protein N-glycosyl chain glucosylation and processing in the biosynthesis of cell wall beta-1,6-glucan of Saccharomyces cerevisiae. Genetics 149(2):843-56
       |CWH41 |KRE5
Reviews
Suzuki T, et al. (1998) Complex, two-way traffic of molecules across the membrane of the endoplasmic reticulum. J Biol Chem 273(17):10083-6
       |KAR2 |SEC61 |SEC62 |SEC63
Function/Process
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Other Features
Knop M, et al. (1996) N-Glycosylation affects endoplasmic reticulum degradation of a mutated derivative of carboxypeptidase yscY in yeast. Yeast 12(12):1229-38
     |MNS1 |PRC1
Cellular Location
DNA/RNA Sequence Features
Function/Process
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Other Features
Protein Physical Properties
Protein Processing/Modification/Regulation
Protein Sequence Features
Strains/Constructs
Techniques and Reagents
Parlati F, et al. (1995) Saccharomyces cerevisiae CNE1 encodes an endoplasmic reticulum (ER) membrane protein with sequence similarity to calnexin and calreticulin and functions as a constituent of the ER quality control apparatus. J Biol Chem 270(1):244-53
       |STE2
Fungal Related Genes/Proteins
Parlati F, et al. (1995) The calnexin homologue cnx1+ in Schizosaccharomyces pombe, is an essential gene which can be complemented by its soluble ER domain. EMBO J 14(13):3064-72

Function/Process
Non-Fungal Related Genes/Proteins
de Virgilio C, et al. (1993) CNE1, a Saccharomyces cerevisiae homologue of the genes encoding mammalian calnexin and calreticulin. Yeast 9(2):185-8

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.