---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

GEM1/YAL048C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrI: 54790 to 52802 CDS: 54790 - 52802 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
GEM1	YAL048C	GON1	ORF, Verified	S000000046
This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community. Gene name reserved on: 2004-06-04. Gene name expires on 2005-06-04.
Description
Evolutionarily-conserved tail-anchored outer mitochondrial membrane GTPase which regulates mitochondrial morphology; cells lacking Gem1p contain collapsed, globular, or grape-like mitochondria; not required for pheromone-induced cell death

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By GTP binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001806 , EBI:IPR005225 , EBI:IPR013684 , EBI:IPR020860 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0342 Assigned on 2007-05-23 UniProtKB GTPase activity Frederick RL, et al. (2004) Yeast Miro GTPase, Gem1p, regulates mitochondrial morphology via a novel pathway. J Cell Biol 167(1):87-98        IDA : Inferred from Direct Assay Assigned on 2005-02-10 SGD calcium ion binding DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR002048 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0106 Assigned on 2007-05-23 UniProtKB hydrolase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0378 Assigned on 2007-05-23 UniProtKB nucleotide binding GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0547 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By mitochondrion inheritance Frederick RL, et al. (2008) Multiple pathways influence mitochondrial inheritance in budding yeast. Genetics 178(2):825-37        IMP : Inferred from Mutant Phenotype IGI : Inferred from Genetic Interaction with SGD:YPT11, SGD:MMR1 Assigned on 2008-06-05 SGD small GTPase mediated signal transduction DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR001806 , EBI:IPR013684 , EBI:IPR020860 Assigned on 2007-05-23 UniProtKB vesicle-mediated transport Wolff AM, et al. (1999) The open reading frame YAL048c affects the secretion of proteinase A in S. cerevisiae. Yeast 15(5):427-34        IMP : Inferred from Mutant Phenotype IGI : Inferred from Genetic Interaction Assigned on 2004-06-04 SGD
Cellular Component Annotation(s) Reference(s) Evidence Assigned By integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9908 Assigned on 2009-10-01 UniProtKB intracellular DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR013684 , EBI:IPR020860 Assigned on 2007-05-23 UniProtKB membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB mitochondrial outer membrane Frederick RL, et al. (2004) Yeast Miro GTPase, Gem1p, regulates mitochondrial morphology via a novel pathway. J Cell Biol 167(1):87-98        IDA : Inferred from Direct Assay Assigned on 2005-02-10 SGD Zahedi RP, et al. (2006) Proteomic analysis of the yeast mitochondrial outer membrane reveals accumulation of a subclass of preproteins. Mol Biol Cell 17(3):1436-50          IDA : Inferred from Direct Assay Assigned on 2006-03-17 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-1000 Assigned on 2009-06-29 UniProtKB mitochondrion Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54            IDA : Inferred from Direct Assay Assigned on 2006-12-12 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0496 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]

SUMMARY PARAGRAPH for GEM1/YAL048C for GEM1 Gem1p (encoded by YAL048C) is a member of the evolutionarily conserved mitochondrial Rho (Miro) subgroup of Rho GTPases (1). A tail-anchored outer mitochondrial membrane protein, Gem1p contains two GTPase domains flanking a pair of calcium-binding EF-hand motifs which are exposed to the cytoplasm and required for function. Cells lacking Gem1p contain collapsed, globular, or grape-like mitochondria, although Gem1p is not an essential component of characterized pathways that regulate mitochondrial dynamics (2). Overexpression of a mutant human Miro protein causes increased apoptotic activity in cultured cells (1), but Gem1p is not required for pheromone-induced yeast cell death. Therefore, Gem1p appears to define a novel mitochondrial morphology pathway which may integrate cell signaling events with mitochondrial dynamics (2). Last Updated: 2005-02-10

Basic References [TOP]

BASIC INFORMATION REFERENCES forGEM1/YAL048C for GEM1 1) Fransson A, et al. (2003) Atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis. J Biol Chem 278(8):6495-502        2) Frederick RL, et al. (2004) Yeast Miro GTPase, Gem1p, regulates mitochondrial morphology via a novel pathway. J Cell Biol 167(1):87-98        3) Wolff AM, et al. (1999) The open reading frame YAL048c affects the secretion of proteinase A in S. cerevisiae. Yeast 15(5):427-34

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for GEM1/YAL048C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for GEM1/YAL048C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MTKETIR C-term KSSKFSK Length(aa) 662 MW(Da) 75,149 pI 5.85 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.068   Codon Adaptation Index 0.144   Frequency of Optimal Codons 0.450   Hydropathicity of Protein -0.155   Aromaticity Score 0.098

10 20 30 40 50 | | | | | MTKETIRVVICGDEGVGKSSLIVSLTKAEFIPTIQDVLPPISIPRDFSSS PTYSPKNTVLIDTSDSDLIALDHELKSADVIWLVYCDHESYDHVSLFWLP HFRSLGLNIPVILCKNKCDSISNVNANAMVVSENSDDDIDTKVEDEEFIP ILMEFKEIDTCIKTSAKTQFDLNQAFYLCQRAITHPISPLFDAMVGELKP LAVMALKRIFLLSDLNQDSYLDDNEILGLQKKCFNKSIDVNELNFIKDLL LDISKHDQEYINRKLYVPGKGITKDGFLVLNKIYAERGRHETTWAILRTF HYTDSLCINDKILHPRLVVPDTSSVELSPKGYRFLVDIFLKFDIDNDGGL NNQELHRLFKCTPGLPKLWTSTNFPFSTVVNNKGCITLQGWLAQWSMTTF LNYSTTTAYLVYFGFQEDARLALQVTKPRKMRRRSGKLYRSNINDRKVFN CFVIGKPCCGKSSLLEAFLGRSFSEEYSPTIKPRIAVNSLELKGGKQYYL ILQELGEQEYAILENKDKLKECDVICLTYDSSDPESFSYLVSLLDKFTHL QDLPLVFVASKADLDKQQQRCQIQPDELADELFVNHPLHISSRWLSSLNE LFIKITEAALDPGKNTPGLPEETAAKDVDYRQTALIFGSTVGFVALCSFT LMKLFKSSKFSK*

Protein Structures from PDB: proteins of known structure with sequence similarity to GEM1/YAL048C, based on Smith-Waterman analysis. [TOP] [NEXT]

PDB protein structure(s) homologous to GEM1 Homolog Source (per PDB) Protein Alignment: GEM1 vs. Homolog External Links P-Value %Identical %Similar Alignment 2j1l ( Chain: A) Crystal structure of human rho-related gtp-binding protein rhod PDB_Info PDB_Structure Homo sapiens 4.5e-06 27 31 View alignment SCOP MMDB CATH 2il1 ( Chain: A) Crystal structure of a predicted human gtpase in complex with gdp PDB_Info PDB_Structure Homo sapiens 8.9e-05 24 36 View alignment SCOP MMDB CATH 1yzu ( Chain: A, B) Gppnhp-bound rab21 gtpase at 2.50 a resolution PDB_Info PDB_Structure Homo sapiens Chain A = 0.000169 21 40 View alignment SCOP MMDB CATH Chain B = 0.000169 21 40 View alignment 1z0i ( Chain: A) Gdp-bound rab21 gtpase PDB_Info PDB_Structure Homo sapiens 0.000169 21 40 View alignment SCOP MMDB CATH 2ot3 ( Chain: B) Crystal structure of rabex-5 vps9 domain in complex with nucleotide free rab21 PDB_Info PDB_Structure Homo sapiens 0.000169 21 40 View alignment SCOP MMDB CATH 1yzt ( Chain: B, A) Gppnhp-bound rab21 gtpase at 2.05 a resolution PDB_Info PDB_Structure Homo sapiens Chain B = 0.000190 21 40 View alignment SCOP MMDB CATH Chain A = 0.000190 21 40 View alignment 2ery ( Chain: A, B) The crystal structure of the ras related protein rras2 (rras2) in the gdp bound state PDB_Info PDB_Structure Homo sapiens Chain A = 0.000289 24 37 View alignment SCOP MMDB CATH Chain B = 0.000289 24 37 View alignment 1z08 ( Chain: A, D, C, B) Gppnhp-bound rab21 q53g mutant gtpase PDB_Info PDB_Structure Homo sapiens Chain A = 0.000339 21 40 View alignment SCOP MMDB CATH Chain D = 0.000339 21 40 View alignment Chain C = 0.000339 21 40 View alignment Chain B = 0.000339 21 40 View alignment 2atx ( Chain: A, B) Crystal structure of the tc10 gppnhp complex PDB_Info PDB_Structure Homo sapiens Chain A = 0.000469 26 28 View alignment SCOP MMDB CATH Chain B = 0.000469 26 28 View alignment 1lb1 ( Chain: D, B, H, F) Crystal structure of the dbl and pleckstrin homology domains of dbs in complex with rhoa PDB_Info PDB_Structure Mus musculus | Homo sapiens Chain D = 0.000900 27 31 View alignment SCOP MMDB CATH Chain B = 0.000900 27 31 View alignment Chain H = 0.000900 27 31 View alignment Chain F = 0.000900 27 31 View alignment 1x86 ( Chain: F, H, B, D) Crystal structure of the dh/ph domains of leukemia- associated rhogef in complex with rhoa PDB_Info PDB_Structure Homo sapiens Chain F = 0.000930 27 31 View alignment SCOP MMDB CATH Chain H = 0.000930 27 31 View alignment Chain B = 0.000930 27 31 View alignment Chain D = 0.000930 27 31 View alignment 2rgn ( Chain: C, F) Crystal structure of p63rhogef complex with galpha-q and rhoa PDB_Info PDB_Structure Mus musculus | Homo sapiens Chain C = 0.000930 27 31 View alignment SCOP MMDB CATH Chain F = 0.000930 27 31 View alignment 2j0v ( Chain: A, D, B, C) The crystal structure of arabidopsis thaliana rac7-rop9: the first ras superfamily gtpase from the plant kingdom PDB_Info PDB_Structure Arabidopsis thaliana Chain A = 0.001400 24 35 View alignment SCOP MMDB CATH Chain D = 0.001400 24 35 View alignment Chain B = 0.001400 24 35 View alignment Chain C = 0.001400 24 35 View alignment 2atv ( Chain: A) The crystal structure of human rerg in the gdp bound state PDB_Info PDB_Structure Homo sapiens 0.001500 27 34 View alignment SCOP MMDB CATH 2wbl ( Chain: D, C) Three-dimensional structure of a binary rop-prone complex PDB_Info PDB_Structure Arabidopsis thaliana Chain D = 0.001599 25 31 View alignment SCOP MMDB CATH Chain C = 0.001599 25 31 View alignment 2wkp ( Chain: A) NPH1-1, RAS-RELATED C3 PDB_Info PDB_Structure Unknown 0.001899 29 19 View alignment SCOP MMDB CATH 1s1c ( Chain: B, A) Crystal structure of the complex between the human rhoa and rho-binding domain of human rocki PDB_Info PDB_Structure Homo sapiens Chain B = 0.001899 27 31 View alignment SCOP MMDB CATH Chain A = 0.001899 27 31 View alignment 2wkq ( Chain: A) NPH1-1, RAS-RELATED C3 PDB_Info PDB_Structure Unknown 0.001899 29 19 View alignment SCOP MMDB CATH 3bwd ( Chain: D) Crystal structure of the plant rho protein rop5 PDB_Info PDB_Structure Arabidopsis thaliana 0.001899 26 32 View alignment SCOP MMDB CATH 2wkr ( Chain: A) NPH1-1, RAS-RELATED C3 PDB_Info PDB_Structure Unknown 0.001899 29 19 View alignment SCOP MMDB CATH 1kao ( Chain: A) Crystal structure of the small g protein rap2a with gdp PDB_Info PDB_Structure Homo sapiens 0.001999 24 39 View alignment SCOP MMDB CATH 3rap ( Chain: R, S) The small g protein rap2 in a non catalytic complex with gtp PDB_Info PDB_Structure Homo sapiens Chain R = 0.001999 24 39 View alignment SCOP MMDB CATH Chain S = 0.001999 24 39 View alignment 2w2x ( Chain: A, B) RAS-RELATED C3 BOTULINU PDB_Info PDB_Structure Unknown Chain A = 0.001999 28 22 View alignment SCOP MMDB CATH Chain B = 0.001999 28 22 View alignment 2w2t ( Chain: A) RAS-RELATED C3 BOTULINU PDB_Info PDB_Structure Unknown 0.001999 28 22 View alignment SCOP MMDB CATH 2rap ( Chain: A) The small g protein rap2a in complex with gtp PDB_Info PDB_Structure Homo sapiens 0.001999 24 39 View alignment SCOP MMDB CATH 1ds6 ( Chain: A) Crystal structure of a rac-rhogdi complex PDB_Info PDB_Structure Homo sapiens 0.002099 28 22 View alignment SCOP MMDB CATH 1a2b ( Chain: A) Human rhoa complexed with gtp analogue PDB_Info PDB_Structure Homo sapiens 0.002299 27 31 View alignment SCOP MMDB CATH 1cxz ( Chain: A) Crystal structure of human rhoa complexed with the effector domain of the protein kinase pkn/prk1 PDB_Info PDB_Structure Homo sapiens 0.002299 27 31 View alignment SCOP MMDB CATH 2nty ( Chain: D, C) Rop4-gdp-prone8 PDB_Info PDB_Structure Arabidopsis thaliana Chain D = 0.003101 26 31 View alignment SCOP MMDB CATH Chain C = 0.003101 26 31 View alignment 2fv8 ( Chain: A) The crystal structure of rhob in the gdp-bound state PDB_Info PDB_Structure Homo sapiens 0.003701 27 29 View alignment SCOP MMDB CATH 1mh1 ( Chain: A) Small g-protein PDB_Info PDB_Structure Homo sapiens 0.003799 27 23 View alignment SCOP MMDB CATH 1u8z ( Chain: B, A) Crystal structures of ral-gppnhp and ral-gdp reveal two novel binding sites that are also present in ras and rap PDB_Info PDB_Structure Saguinus oedipus Chain B = 0.003899 22 40 View alignment SCOP MMDB CATH Chain A = 0.003899 22 40 View alignment 1u90 ( Chain: A, B) Crystal structures of ral-gppnhp and ral-gdp reveal two novel binding sites that are also present in ras and rap PDB_Info PDB_Structure Saguinus oedipus Chain A = 0.003899 22 40 View alignment SCOP MMDB CATH Chain B = 0.003899 22 40 View alignment 1u8y ( Chain: A, B) Crystal structures of ral-gppnhp and ral-gdp reveal two novel binding sites that are also present in ras and rap PDB_Info PDB_Structure Saguinus oedipus Chain A = 0.003899 22 40 View alignment SCOP MMDB CATH Chain B = 0.003899 22 40 View alignment 2fol ( Chain: A) Crystal structure of human rab1a in complex with gdp PDB_Info PDB_Structure Homo sapiens 0.004001 24 31 View alignment SCOP MMDB CATH 1cf4 ( Chain: A) Cdc42/ack gtpase-binding domain complex PDB_Info PDB_Structure Homo sapiens 0.004400 26 28 View alignment SCOP MMDB CATH 1e0a ( Chain: A) Cdc42 complexed with the gtpase binding domain of p21 activated kinase PDB_Info PDB_Structure Homo sapiens | Rattus norvegicus 0.004400 26 28 View alignment SCOP MMDB CATH 1g4u ( Chain: R) Crystal structure of the salmonella tyrosine phosphatase and gtpase activating protein sptp bound to rac1 PDB_Info PDB_Structure Salmonella typhimurium | Homo sapiens 0.004400 28 22 View alignment SCOP MMDB CATH 2p2l ( Chain: A, B, C) Rac1-gdp-zinc complex PDB_Info PDB_Structure Homo sapiens Chain A = 0.004598 28 22 View alignment SCOP MMDB CATH Chain B = 0.004598 28 22 View alignment Chain C = 0.004598 28 22 View alignment 2h7v ( Chain: B, A) Co-crystal structure of ypka-rac1 PDB_Info PDB_Structure Homo sapiens | Yersinia pseudotuberculosis Chain B = 0.004598 28 22 View alignment SCOP MMDB CATH Chain A = 0.004598 28 22 View alignment 1hh4 ( Chain: A, B) Rac1-rhogdi complex involved in nadph oxidase activation PDB_Info PDB_Structure Homo sapiens Chain A = 0.004700 28 22 View alignment SCOP MMDB CATH Chain B = 0.004700 28 22 View alignment 1nf3 ( Chain: B, A) Structure of cdc42 in a complex with the gtpase-binding domain of the cell polarity protein, par6 PDB_Info PDB_Structure Homo sapiens | Mus musculus Chain B = 0.004800 26 28 View alignment SCOP MMDB CATH Chain A = 0.004800 26 28 View alignment 2fn4 ( Chain: A) The crystal structure of human ras-related protein, rras, in the gdp-bound state PDB_Info PDB_Structure Homo sapiens 0.005097 24 37 View alignment SCOP MMDB CATH 2w2v ( Chain: C, B, D, A) RAS-RELATED C3 BOTULINU PDB_Info PDB_Structure Unknown Chain C = 0.005200 28 22 View alignment SCOP MMDB CATH Chain B = 0.005200 28 22 View alignment Chain D = 0.005200 28 22 View alignment Chain A = 0.005200 28 22 View alignment 1aje ( Chain: A) Cdc42 from human, nmr, 20 structures PDB_Info PDB_Structure Homo sapiens 0.005599 25 31 View alignment SCOP MMDB CATH 2q3h ( Chain: A) The crystal structure of rhoua in the gdp-bound state. PDB_Info PDB_Structure Homo sapiens 0.005898 29 24 View alignment SCOP MMDB CATH 1x1s ( Chain: A) Crystal structure of m-ras in complex with gppnhp PDB_Info PDB_Structure Mus musculus 0.005898 23 37 View alignment SCOP MMDB CATH 1x1r ( Chain: A) Crystal structure of m-ras in complex with gdp PDB_Info PDB_Structure Mus musculus 0.005898 23 37 View alignment SCOP MMDB CATH 1cc0 ( Chain: C, A) Crystal structure of the rhoa.gdp-rhogdi complex PDB_Info PDB_Structure Homo sapiens Chain C = 0.006402 27 30 View alignment SCOP MMDB CATH Chain A = 0.006402 27 30 View alignment 1ftn ( Chain: A) Crystal structure of the human rhoa/gdp complex PDB_Info PDB_Structure Homo sapiens 0.006597 27 30 View alignment SCOP MMDB CATH 1ow3 ( Chain: B) Crystal structure of rhoa.gdp.mgf3-in complex with rhogap PDB_Info PDB_Structure Homo sapiens 0.006597 27 30 View alignment SCOP MMDB CATH 2o52 ( Chain: B, A) Crystal structure of human rab4b in complex with gdp PDB_Info PDB_Structure Homo sapiens Chain B = 0.006901 24 33 View alignment SCOP MMDB CATH Chain A = 0.006901 24 33 View alignment 1cee ( Chain: A) Solution structure of cdc42 in complex with the gtpase binding domain of wasp PDB_Info PDB_Structure Homo sapiens 0.006998 25 31 View alignment SCOP MMDB CATH 1kz7 ( Chain: B, D) Crystal structure of the dh/ph fragment of murine dbs in complex with the placental isoform of human cdc42 PDB_Info PDB_Structure Mus musculus | Homo sapiens Chain B = 0.007498 25 31 View alignment SCOP MMDB CATH Chain D = 0.007498 25 31 View alignment 1ki1 ( Chain: A, C) Guanine nucleotide exchange region of intersectin in complex with cdc42 PDB_Info PDB_Structure Homo sapiens Chain A = 0.007498 25 31 View alignment SCOP MMDB CATH Chain C = 0.007498 25 31 View alignment 1kzg ( Chain: B, D) Dbscdc42(y889f) PDB_Info PDB_Structure Mus musculus | Homo sapiens Chain B = 0.007498 25 31 View alignment SCOP MMDB CATH Chain D = 0.007498 25 31 View alignment 2qrz ( Chain: B, A) Cdc42 bound to gmp-pcp: induced fit by effector is required PDB_Info PDB_Structure Homo sapiens Chain B = 0.007498 25 31 View alignment SCOP MMDB CATH Chain A = 0.007498 25 31 View alignment 1an0 ( Chain: B, A) Cdc42hs-gdp complex PDB_Info PDB_Structure Homo sapiens Chain B = 0.007597 25 31 View alignment SCOP MMDB CATH Chain A = 0.007597 25 31 View alignment 2wm9 ( Chain: B) CELL DIVISION CONTROL P PDB_Info PDB_Structure Unknown 0.007597 25 31 View alignment SCOP MMDB CATH 2wmn ( Chain: B) CELL DIVISION CONTROL P PDB_Info PDB_Structure Unknown 0.007597 25 31 View alignment SCOP MMDB CATH 2wmo ( Chain: B) CELL DIVISION CONTROL P PDB_Info PDB_Structure Unknown 0.007597 25 31 View alignment SCOP MMDB CATH 1grn ( Chain: A) Crystal structure of the cdc42/cdc42gap/alf3 complex. PDB_Info PDB_Structure Homo sapiens 0.007597 25 31 View alignment SCOP MMDB CATH 2ngr ( Chain: A) Transition state complex for gtp hydrolysis by cdc42: comparisons of the high resolution structures for cdc42 bound to the active and catalytically compromised forms of the cdc42-gap. PDB_Info PDB_Structure Homo sapiens 0.007597 25 31 View alignment SCOP MMDB CATH 1doa ( Chain: A) Structure of the rho family gtp-binding protein cdc42 in complex with the multifunctional regulator rhogdi PDB_Info PDB_Structure Homo sapiens | Bos taurus 0.007597 25 31 View alignment SCOP MMDB CATH 2odb ( Chain: A) The crystal structure of human cdc42 in complex with the crib domain of human p21-activated kinase 6 (pak6) PDB_Info PDB_Structure Homo sapiens 0.007696 25 31 View alignment SCOP MMDB CATH 2dfk ( Chain: D, B) Crystal structure of the cdc42-collybistin ii complex PDB_Info PDB_Structure Rattus norvegicus | Homo sapiens Chain D = 0.007797 25 31 View alignment SCOP MMDB CATH Chain B = 0.007797 25 31 View alignment 1uad ( Chain: A, B) Crystal structure of the rala-gppnhp-sec5 ral-binding domain complex PDB_Info PDB_Structure Homo sapiens | Rattus norvegicus Chain A = 0.008002 21 41 View alignment SCOP MMDB CATH Chain B = 0.008002 21 41 View alignment 2bme ( Chain: D, B, A, C) High resolution structure of gppnhp-bound human rab4a PDB_Info PDB_Structure Homo sapiens Chain D = 0.008703 23 35 View alignment SCOP MMDB CATH Chain B = 0.008703 23 35 View alignment Chain A = 0.008703 23 35 View alignment Chain C = 0.008703 23 35 View alignment 2bmd ( Chain: A) High resolution structure of gdp-bound human rab4a PDB_Info PDB_Structure Homo sapiens 0.008703 23 35 View alignment SCOP MMDB CATH 2a9k ( Chain: A) Crystal structure of the c3bot-nad-rala complex reveals a novel type of action of a bacterial exoenzyme PDB_Info PDB_Structure Homo sapiens | Clostridium botulinum d phage 0.008800 21 41 View alignment SCOP MMDB CATH 2a78 ( Chain: A) Crystal structure of the c3bot-rala complex reveals a novel type of action of a bacterial exoenzyme PDB_Info PDB_Structure Homo sapiens | Clostridium botulinum d phage 0.008800 21 41 View alignment SCOP MMDB CATH 3brw ( Chain: D) Structure of the rap-rapgap complex PDB_Info PDB_Structure Homo sapiens 0.008897 24 37 View alignment SCOP MMDB CATH 3cf6 ( Chain: R) Structure of epac2 in complex with cyclic-amp and rap PDB_Info PDB_Structure Mus musculus | Homo sapiens 0.008897 24 37 View alignment SCOP MMDB CATH 1gua ( Chain: A) Human rap1a, residues 1-167, double mutant (e30d,k31e) complexed with gppnhp and the ras-binding-domain of human c-raf1, residues 51-131 PDB_Info PDB_Structure Homo sapiens 0.008897 24 37 View alignment SCOP MMDB CATH 1a4r ( Chain: B, A) G12v mutant of human placental cdc42 gtpase in the gdp form PDB_Info PDB_Structure Homo sapiens Chain B = 0.008995 25 31 View alignment SCOP MMDB CATH Chain A = 0.008995 25 31 View alignment 2bov ( Chain: A) Molecular recognition of an adp-ribosylating clostridium botulinum c3 exoenzyme by rala gtpase PDB_Info PDB_Structure Homo sapiens | Clostridium botulinum 0.009902 21 41 View alignment SCOP MMDB CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Date Standardized	Reference
GEM1	2005-01-25	Frederick RL, et al. (2004) Yeast Miro GTPase, Gem1p, regulates mitochondrial morphology via a novel pathway. J Cell Biol 167(1):87-98

Nomenclature History Notes

Date	Note
2004-06-04	YMR1 was a reserved name for YAL048C for a very short period (month). However, the gene name YMR1 was used to name YJR110W in PMID:10900271. Hence, this gene name reservation was dropped and the concerned authors have reserved GEM1 name for YAL048C (2004-06-04).
2004-04-27	GON1 was a reserved name for YAL048C for a brief period, but never published. GON1 was moved to be an alias name for YAL048C upon the author's (Jeff Coller) request.

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YAL048C	SGD Systematic Sequence
851249	NCBI: Gene ID
NP_009351.1	NCBI: RefSeq protein version ID
NP_009351.1	NCBI: RefSeq protein version ID
6319268	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
11 curated references; 0 references not yet curated
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Garcia-Rodriguez LJ, et al. (2009) Mitochondrial inheritance is required for MEN-regulated cytokinesis in budding yeast. Curr Biol 19(20):1730-5	|BUB2 |CDC14 |CDC5 |MDM10 |MDM12 |MMM1 |MMR1
Function/Process Genetic Interactions	Kornmann B, et al. (2009) An ER-mitochondria tethering complex revealed by a synthetic biology screen. Science 325(5939):477-81	|CRD1 |MDM10 |MDM12 |MDM34 |MMM1 |PSD1 |TOM70 |UBC6
Evolution Non-Fungal Related Genes/Proteins	Szklarczyk R and Huynen MA (2009) Expansion of the human mitochondrial proteome by intra- and inter-compartmental protein duplication. Genome Biol 10(11):R135	|AAC1 |AAC3 |AAT2 |ABC1 |ACN9 |ACO1 |ACP1 |ADK1 |ADK2 |AGC1 |AHP1 |ALD4 |ALD5 |ALD6 |MORE
Genetic Interactions Mutants/Phenotypes	Frederick RL, et al. (2008) Multiple pathways influence mitochondrial inheritance in budding yeast. Genetics 178(2):825-37	|AAH1 |AEP1 |AIM11 |APP1 |ARO8 |ATP1 |ATP10 |ATP12 |ATP7 |BRE5 |CCE1 |CHO2 |COQ5 |COX19 |MORE
Mutants/Phenotypes Techniques and Reagents	Freimoser FM, et al. (2006) Systematic screening of polyphosphate (poly P) levels in yeast mutant cells reveals strong interdependence with primary metabolism. Genome Biol 7(11):R109	|ADE1 |ADE3 |AKR1 |ALT2 |APL5 |APL6 |APM3 |APS3 |ARO1 |ARP5 |ATG12 |ATG20 |ATP15 |AVT6 |MORE
Cellular Location	Reinders J, et al. (2006) Toward the complete yeast mitochondrial proteome: multidimensional separation techniques for mitochondrial proteomics. J Proteome Res 5(7):1543-54	|AAC1 |AAC3 |AAT1 |ABC1 |ABF2 |ACC1 |ACH1 |ACK1 |ACN9 |ACO1 |ACO2 |ACP1 |ACS1 |ADH3 |MORE
Cellular Location	Zahedi RP, et al. (2006) Proteomic analysis of the yeast mitochondrial outer membrane reveals accumulation of a subclass of preproteins. Mol Biol Cell 17(3):1436-50	|AFG1 |AIM18 |ALD4 |ALO1 |ATP15 |ATP2 |ATP3 |ATP5 |AYR1 |BNA4 |CBR1 |CIR1 |COR1 |CYB2 |MORE
Reviews	Okamoto K and Shaw JM (2005) Mitochondrial morphology and dynamics in yeast and multicellular eukaryotes. Annu Rev Genet 39:503-36	|CAF4 |DNM1 |FIS1 |FZO1 |MDM10 |MDM12 |MDM31 |MDM32 |MDM34 |MDV1 |MGM1 |MMM1 |SHE9 |UGO1
Cellular Location Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Sequence Features Strains/Constructs	Frederick RL, et al. (2004) Yeast Miro GTPase, Gem1p, regulates mitochondrial morphology via a novel pathway. J Cell Biol 167(1):87-98
Non-Fungal Related Genes/Proteins	Fransson A, et al. (2003) Atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis. J Biol Chem 278(8):6495-502
Mutants/Phenotypes Non-Fungal Related Genes/Proteins Protein Sequence Features Strains/Constructs	Wolff AM, et al. (1999) The open reading frame YAL048c affects the secretion of proteinase A in S. cerevisiae. Yeast 15(5):427-34	|PEP4

Return to SGD

Send a Message to the SGD Curators