ERV46/YAL042W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrI: 61317 to 62564
CDS: 61317 - 62564

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

ERV46 YAL042W FUN9 ORF, Verified S000000040

This name is reserved with SGD according to the Gene Naming Guidelines agreed upon by the yeast community.
Gene name reserved on: 2000-08-01. Gene name expires on 2001-08-01.
Description
Protein localized to COPII-coated vesicles, forms a complex with Erv41p; involved in the membrane fusion stage of transport

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
molecular_function
unknown SGD (2002) Use of the ND evidence code for Gene Ontology (GO) terms in SGD
   ND : No Biological Data Available
Assigned on 2002-07-16 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
ER to Golgi vesicle-mediated transport Otte S, et al. (2001) Erv41p and Erv46p: new components of COPII vesicles involved in transport between the ER and Golgi complex. J Cell Biol 152(3):503-18
       IPI : Inferred from Physical Interaction
Assigned on 2002-07-16 SGD
protein transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0653
Assigned on 2007-05-23 UniProtKB
transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0813
Assigned on 2007-05-23 UniProtKB
vesicle-mediated transport GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0931
Assigned on 2008-02-14 UniProtKB
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
ER to Golgi transport vesicle Otte S, et al. (2001) Erv41p and Erv46p: new components of COPII vesicles involved in transport between the ER and Golgi complex. J Cell Biol 152(3):503-18
       IDA : Inferred from Direct Assay
Assigned on 2002-07-16 SGD
Golgi apparatus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0333
Assigned on 2008-02-14 UniProtKB
endoplasmic reticulum GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23 UniProtKB
integral to Golgi membrane Otte S, et al. (2001) Erv41p and Erv46p: new components of COPII vesicles involved in transport between the ER and Golgi complex. J Cell Biol 152(3):503-18
       IDA : Inferred from Direct Assay
Assigned on 2002-07-16 SGD
integral to endoplasmic reticulum membrane Otte S, et al. (2001) Erv41p and Erv46p: new components of COPII vesicles involved in transport between the ER and Golgi complex. J Cell Biol 152(3):503-18
       IDA : Inferred from Direct Assay
Assigned on 2002-07-16 SGD
integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forERV46/YAL042W for ERV46
1) Coleman KG, et al. (1986) Molecular cloning of chromosome I DNA from Saccharomyces cerevisiae: isolation and characterization of the CDC24 gene and adjacent regions of the chromosome. Mol Cell Biol 6(12):4516-25

2) Otte S, et al. (2001) Erv41p and Erv46p: new components of COPII vesicles involved in transport between the ER and Golgi complex. J Cell Biol 152(3):503-18

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for ERV46/YAL042W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for ERV46/YAL042W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MKRSTLL

C-term IWGKKSQ

Length(aa) 415

MW(Da) 46,235

pI 6.81

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.096

Codon Adaptation Index 0.118

Frequency of Optimal Codons 0.460

Hydropathicity of Protein -0.400

Aromaticity Score 0.089

10 20 30 40 50 | | | | | MKRSTLLSLDAFAKTEEDVRVRTRAGGLITLSCILTTLFLLVNEWGQFNS VVTRPQLVVDRDRHAKLELNMDVTFPSMPCDLVNLDIMDDSGEMQLDILD AGFTMSRLNSEGRPVGDATELHVGGNGDGTAPVNNDPNYCGPCYGAKDQS QNENLAQEEKVCCQDCDAVRSAYLEAGWAFFDGKNIEQCEREGYVSKINE HLNEGCRIKGSAQINRIQGNLHFAPGKPYQNAYGHFHDTSLYDKTSNLNF NHIINHLSFGKPIQSHSKLLGNDKRHGGAVVATSPLDGRQVFPDRNTHFH QFSYFAKIVPTRYEYLDNVVIETAQFSATFHSRPLAGGRDKDHPNTLHVR GGIPGMFVFFEMSPLKVINKEQHGQTWSGFILNCITSIGGVLAVGTVMDK LFYKAQRSIWGKKSQ*

Protein Structures from PDB: proteins of known structure with sequence similarity to ERV46/YAL042W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Date Standardized Reference
ERV46 2000-08-01 SGD (2007) Information without a citation in SGD

Alias Name(s) Reference
FUN9 Coleman KG, et al. (1986) Molecular cloning of chromosome I DNA from Saccharomyces cerevisiae: isolation and characterization of the CDC24 gene and adjacent regions of the chromosome. Mol Cell Biol 6(12):4516-25

Standard Name	Date Standardized	Reference
ERV46	2000-08-01	SGD (2007) Information without a citation in SGD

Alias Name(s)	Reference
FUN9	*Coleman KG, et al.* (1986)** Molecular cloning of chromosome I DNA from Saccharomyces cerevisiae: isolation and characterization of the CDC24 gene and adjacent regions of the chromosome. Mol Cell Biol 6(12):4516-25

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YAL042W SGD Systematic Sequence

851256 NCBI: Gene ID

NP_009358.1 NCBI: RefSeq protein version ID

NP_009358.1 NCBI: RefSeq protein version ID

6319274 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YAL042W	SGD Systematic Sequence
851256	NCBI: Gene ID
NP_009358.1	NCBI: RefSeq protein version ID
NP_009358.1	NCBI: RefSeq protein version ID
6319274	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
17 curated references; 0 references not yet curated
Genetic Interactions
Kim JH, et al. (2009) The unfolded protein response is necessary but not sufficient to compensate for defects in disulfide isomerization. J Biol Chem 284(16):10400-8
         |ALG8 |APM3 |APS3 |ARL1 |AVL9 |CCZ1 |CDC50 |COG8 |EPS1 |ERV41 |EUG1 |FLD1 |GCS1 |GEF1 |MORE
Mutants/Phenotypes
Non-Fungal Related Genes/Proteins
Li F, et al. (2008) Thiopurine S-methyltransferase pharmacogenetics: autophagy as a mechanism for variant allozyme degradation. Pharmacogenet Genomics 18(12):1083-94
     |ADY3 |APE3 |ATG10 |ATG12 |ATG3 |ATG5 |ATG7 |ATG8 |BUD14 |CNE1 |CPS1 |CUE1 |ERP1 |ERP2 |MORE
Mutants/Phenotypes
Strains/Constructs
Ruotolo R, et al. (2008) Membrane transporters and protein traffic networks differentially affecting metal tolerance: a genomic phenotyping study in yeast. Genome Biol 9(4):R67
       |AAT2 |AFT1 |ALF1 |APL5 |APL6 |APM3 |APS3 |ARO2 |BCK1 |BUB3 |CCC2 |CCR4 |CDC10 |CLC1 |MORE
Reviews
Baines AC and Zhang B (2007) Receptor-mediated protein transport in the early secretory pathway. Trends Biochem Sci 32(8):381-8
       |EMP24 |EMP46 |EMP47 |ERV14 |ERV25 |ERV29 |ERV41 |SAR1 |SEC13 |SEC23 |SEC24 |SEC31 |SFB2 |SFB3 |MORE
Mutants/Phenotypes
Bishop AL, et al. (2007) Phenotypic heterogeneity can enhance rare-cell survival in 'stress-sensitive' yeast populations. Mol Microbiol 63(2):507-20
       |ADE12 |ADE2 |ADH5 |AGP2 |AIM10 |AIM7 |ARE2 |ATP1 |BUD5 |CBP6 |CCE1 |CCS1 |COX6 |CSE2 |MORE
Mutants/Phenotypes
Techniques and Reagents
Freimoser FM, et al. (2006) Systematic screening of polyphosphate (poly P) levels in yeast mutant cells reveals strong interdependence with primary metabolism. Genome Biol 7(11):R109
       |ADE1 |ADE3 |AKR1 |ALT2 |APL5 |APL6 |APM3 |APS3 |ARO1 |ARP5 |ATG12 |ATG20 |ATP15 |AVT6 |MORE
Protein-Nucleic Acid Interactions
Sikder D, et al. (2006) Widespread, but non-identical, association of proteasomal 19 and 20 S proteins with yeast chromatin. J Biol Chem 281(37):27346-55
       |ACH1 |ADE1 |ADE4 |ADE8 |ADH6 |AGE2 |ARN1 |ATG10 |BAP3 |BUL1 |COR1 |COX1 |CYB2 |DLD1 |MORE
Protein Processing/Modification/Regulation
Techniques and Reagents
Tagwerker C, et al. (2006) A tandem affinity tag for two-step purification under fully denaturing conditions: application in ubiquitin profiling and protein complex identification combined with in vivocross-linking. Mol Cell Proteomics 5(4):737-48
         |AAC1 |AAC3 |ACB1 |ACC1 |ACS2 |ADE3 |ADE5,7 |ADE6 |ADH4 |ADO1 |AGP1 |AHA1 |AHP1 |ALA1 |MORE
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Welsh LM, et al. (2006) Genetic and molecular interactions of the Erv41p-Erv46p complex involved in transport between the endoplasmic reticulum and Golgi complex. J Cell Sci 119(Pt 22):4730-40
         |ERV41 |ROT2 |VMA21 |VMA22 |VPH2 |VPS1
Cellular Location
Inadome H, et al. (2005) Immunoisolaton of the yeast Golgi subcompartments and characterization of a novel membrane protein, Svp26, discovered in the Sed5-containing compartments. Mol Cell Biol 25(17):7696-710
       |AKR1 |ANP1 |ARF1 |ATG27 |DPM1 |EHT1 |EMP24 |EMP47 |ERP1 |ERP2 |ERV14 |ERV25 |ERV41 |GCS1 |MORE
Protein-protein Interactions
Millson SH, et al. (2005) A two-hybrid screen of the yeast proteome for Hsp90 interactors uncovers a novel Hsp90 chaperone requirement in the activity of a stress-activated mitogen-activated protein kinase, Slt2p (Mpk1p). Eukaryot Cell 4(5):849-60
         |ACF4 |ACT1 |AGP2 |AHA1 |AIM2 |AIM37 |ANT1 |AQR1 |ARE1 |ARE2 |ARG4 |ARR3 |ASG7 |ATG14 |MORE
Non-Fungal Related Genes/Proteins
Breuza L, et al. (2004) Proteomics of endoplasmic reticulum-Golgi intermediate compartment (ERGIC) membranes from brefeldin A-treated HepG2 cells identifies ERGIC-32, a new cycling protein that interacts with human Erv46. J Biol Chem 279(45):47242-53
       |ERV41
Mutants/Phenotypes
Regulatory Role
Strains/Constructs
Gillingham AK, et al. (2004) The GTPase Arf1p and the ER to Golgi cargo receptor Erv14p cooperate to recruit the golgin Rud3p to the cis-Golgi. J Cell Biol 167(2):281-92
         |ARF1 |ARF3 |ARL1 |EMP24 |EMP47 |ERV14 |ERV29 |RER1 |RUD3 |YIP3 |YPT1 |YPT31 |YPT32 |YPT6
Cellular Location
Function/Process
Protein Sequence Features
Regulation of
Otte S and Barlowe C (2002) The Erv41p-Erv46p complex: multiple export signals are required in trans for COPII-dependent transport from the ER. EMBO J 21(22):6095-104
         |ERV41
Cellular Location
Function/Process
Fungal Related Genes/Proteins
Non-Fungal Related Genes/Proteins
Protein-protein Interactions
Techniques and Reagents
Cho JH, et al. (2001) A novel membrane protein complex on the endoplasmic reticulum and early Golgi compartments in the yeast Saccharomyces cerevisiae. Biosci Biotechnol Biochem 65(10):2226-32
     |ERV41
Cellular Location
Function/Process
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
RNA Levels and Processing
Techniques and Reagents
Otte S, et al. (2001) Erv41p and Erv46p: new components of COPII vesicles involved in transport between the ER and Golgi complex. J Cell Biol 152(3):503-18
       |BET1 |EMP24 |EMP47 |ERP1 |ERP2 |ERV14 |ERV25 |ERV29 |ERV41 |RER1 |YIF1 |YIP3 |YPT1
Mapping
RNA Levels and Processing
Diehl BE and Pringle JR (1991) Molecular analysis of Saccharomyces cerevisiae chromosome I: identification of additional transcribed regions and demonstration that some encode essential functions. Genetics 127(2):287-98
     |CDC19 |CDC24 |CLN3 |CYC3 |FUN12 |FUN19 |GIP4 |MYO4 |PRP45 |RBG1

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.