---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

PMT2/YAL023C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrI: 108552 to 106273 CDS: 108552 - 106273 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
PMT2	YAL023C	FUN25	ORF, Verified	S000000021
Description
Protein O-mannosyltransferase, transfers mannose residues from dolichyl phosphate-D-mannose to protein serine/threonine residues; acts in a complex with Pmt1p, can instead interact with Pmt5p in some conditions; target for new antifungals

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By dolichyl-phosphate-mannose-protein mannosyltransferase activity Lussier M, et al. (1995) Protein O-glycosylation in yeast. The PMT2 gene specifies a second protein O-mannosyltransferase that functions in addition to the PMT1-encoded activity. J Biol Chem 270(6):2770-5        IMP : Inferred from Mutant Phenotype ISS : Inferred from Sequence or structural Similarity Assigned on 2001-01-18 SGD GOA curators and MGI curators (2001) Gene Ontology annotation based on Enzyme Commission mapping.      IEA : Inferred from Electronic Annotation with IUBMB:2.4.1.109 Assigned on 2007-05-23 UniProtKB mannosyltransferase activity DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR003342 Assigned on 2007-05-23 UniProtKB transferase activity GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0808 Assigned on 2007-05-23 UniProtKB transferase activity, transferring glycosyl groups GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0328 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By cellular carbohydrate metabolic process Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT peptidyl-amino acid modification Huttenhower C and Troyanskaya OG (2009) Prediction of Gene Ontology annotations by integrating high-throughput datasets    RCA : Reviewed Computational Analysis Assigned on 2009-08-06 bioPIXIE_MEFIT protein amino acid O-linked glycosylation Lussier M, et al. (1995) Protein O-glycosylation in yeast. The PMT2 gene specifies a second protein O-mannosyltransferase that functions in addition to the PMT1-encoded activity. J Biol Chem 270(6):2770-5        IMP : Inferred from Mutant Phenotype ISS : Inferred from Sequence or structural Similarity Assigned on 2001-01-18 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR003342 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By endoplasmic reticulum Gentzsch M and Tanner W (1996) The PMT gene family: protein O-glycosylation in Saccharomyces cerevisiae is vital. EMBO J 15(21):5752-9      TAS : Traceable Author Statement Assigned on 2001-01-18 SGD GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0256 Assigned on 2007-05-23 UniProtKB integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB membrane DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR003342 , EBI:IPR003608 , EBI:IPR016093 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
protein modifications

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forPMT2/YAL023C for PMT2 1) Lussier M, et al. (1995) Protein O-glycosylation in yeast. The PMT2 gene specifies a second protein O-mannosyltransferase that functions in addition to the PMT1-encoded activity. J Biol Chem 270(6):2770-5        2) Girrbach V and Strahl S (2003) Members of the evolutionarily conserved PMT family of protein O-mannosyltransferases form distinct protein complexes among themselves. J Biol Chem 278(14):12554-62

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for PMT2/YAL023C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for PMT2/YAL023C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MSSSSST C-term IADKQEA Length(aa) 759 MW(Da) 86,869 pI 7.68 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.337   Codon Adaptation Index 0.240   Frequency of Optimal Codons 0.599   Hydropathicity of Protein -0.052   Aromaticity Score 0.148

10 20 30 40 50 | | | | | MSSSSSTGYSKNNAAHIKQENTLRQRESSSISVSEELSSADERDAEDFSK EKPAAQSSLLRLESVVMPVIFTALALFTRMYKIGINNHVVWDEAHFGKFG SYYLRHEFYHDVHPPLGKMLVGLSGYLAGYNGSWDFPSGEIYPDYLDYVK MRLFNASFSALCVPLAYFTAKAIGFSLPTVWLMTVLVLFENSYSTLGRFI LLDSMLLFFTVASFFSFVMFHNQRSKPFSRKWWKWLLITGISLGCTISVK MVGLFIITMVGIYTVIDLWTFLADKSMSWKTYINHWLARIFGLIIVPFCI FLLCFKIHFDLLSHSGTGDANMPSLFQARLVGSDVGQGPRDIALGSSVVS IKNQALGGSLLHSHIQTYPDGSNQQQVTCYGYKDANNEWFFNRERGLPSW SENETDIEYLKPGTSYRLVHKSTGRNLHTHPVAAPVSKTQWEVSGYGDNV VGDNKDNWVIEIMDQRGDEDPEKLHTLTTSFRIKNLEMGCYLAQTGNSLP EWGFRQQEVVCMKNPFKRDKRTWWNIETHENERLPPRPEDFQYPKTNFLK DFIHLNLAMMATNNALVPDPDKFDYLASSAWQWPTLNVGLRLCGWGDDNP KYFLLGTPASTWASSVAVLAFMATVVILLIRWQRQYVDLRNPSNWNVFLM GGFYPLLAWGLHYMPFVIMSRVTYVHHYLPALYFALIILAYCFDAGLQKW SRSKCGRIMRFVLYAGFMALVIGCFWYFSPISFGMEGPSSNFRYLNWFST WDIADKQEA*

Protein Structures from PDB: proteins of known structure with sequence similarity to PMT2/YAL023C, based on Smith-Waterman analysis. [TOP] [NEXT]
PDB protein structure(s) homologous to PMT2 Homolog Source (per PDB) Protein Alignment: PMT2 vs. Homolog External Links P-Value %Identical %Similar Alignment 1t9f ( Chain: A) Structural genomics of caenorhabditis elegans: structure of a protein with unknown function PDB_Info PDB_Structure Caenorhabditis elegans 1.0e-10 33 28 View alignment SCOP MMDB CATH

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
PMT2	SGD (2007) Information without a citation in SGD

Sequence Annotation Notes

Date

Note

2002-12-17

Due to the insertion of CC after the C at 108137, and the insertion of a G after the G at 108143 in the systematic sequence of Chromosome I, the coordinates of PMT2/YAL023C have been changed. Thanks to Verena Girrbach (verena.girrbach@biologie.uni-regensburg.de) for reporting this sequence error in the systematic sequence of PMT2/FUN25/YAL023C to SGD. Old: 108121 AGTCTGGGTAAATTTCC--AGAAGG-AAGTCCCAAGAACCGTTGTAGCCTGCCAAATAAC 108177 ||||||||||||||||| |||||| |||||||||||||||||||||||||||||||||| New: 108121 AGTCTGGGTAAATTTCCCCAGAAGGGAAGTCCCAAGAACCGTTGTAGCCTGCCAAATAAC 108180

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YAL023C	SGD Systematic Sequence
851210	NCBI: Gene ID
NP_009379.2	NCBI: RefSeq protein version ID
NP_009379.2	NCBI: RefSeq protein version ID
27469358	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YeastRC Localization (Seattle) YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
46 curated references; 0 references not yet curated
Reviews	Chiba Y and Akeboshi H (2009) Glycan engineering and production of 'humanized' glycoprotein in yeast cells. Biol Pharm Bull 32(5):786-95	|KTR6 |MNN1 |MNN4 |OCH1 |PMT1 |PMT3 |PMT4 |PMT5 |PMT6
Fungal Related Genes/Proteins	Fernandez-Alvarez A, et al. (2009) The O-Mannosyltransferase PMT4 Is Essential for Normal Appressorium Formation and Penetration in Ustilago maydis. Plant Cell 21(10):3397-412	|KRE2 |MNN1 |MNT4 |PMT1 |PMT4
Regulation of Transcription	Kirmizis A, et al. (2009) Distinct transcriptional outputs associated with mono- and dimethylated histone H3 arginine 2. Nat Struct Mol Biol 16(4):449-51	|BRE2 |ECM19 |HHF2 |HHT1 |HHT2 |HOP1 |SDC1 |SET1 |SHG1 |SPP1 |SPR3 |SWD1 |SWD2 |SWD3
Mutants/Phenotypes	Murakami-Sekimata A, et al. (2009) O-Mannosylation is required for the solubilization of heterologously expressed human beta-amyloid precursor protein in Saccharomyces cerevisiae. Genes Cells 14(2):205-15	|PMT1 |PMT4 |SEC12 |SEC18
Fungal Related Genes/Proteins	Willger SD, et al. (2009) Characterization of the PMT gene family in Cryptococcus neoformans. PLoS One 4(7):e6321	|PMT1 |PMT4
Function/Process Mutants/Phenotypes Strains/Constructs	Hirayama H, et al. (2008) O-Mannosylation is Required for Degradation of the Endoplasmic Reticulum-associated Degradation Substrate Gas1*p via the Ubiquitin/Proteasome Pathway in Saccharomyces cerevisiae. J Biochem 143(4):555-67	|GAS1 |KRE2 |KTR1 |KTR3 |PEP4 |PMT1 |PMT4 |PMT6 |VPS30 |VPS38
Function/Process Mutants/Phenotypes Strains/Constructs	Izquierdo A, et al. (2008) Saccharomyces cerevisiae Grx6 and Grx7 are monothiol glutaredoxins associated with the early secretory pathway. Eukaryot Cell 7(8):1415-26	|CRZ1 |GRX6 |GRX7 |MSN2 |MSN4 |PMT1
Reviews	Jigami Y (2008) Yeast glycobiology and its application. Biosci Biotechnol Biochem 72(3):637-48	|ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG5 |ALG6 |ALG7 |ALG8 |ALG9 |ANP1 |CWH41 |MORE
Reviews	Lengeler KB, et al. (2008) Protein-O-mannosyltransferases in virulence and development. Cell Mol Life Sci 65(4):528-44	|AGA1 |AGA2 |AXL2 |BAR1 |CIS3 |CTS1 |FUS1 |GAS1 |HSP150 |KEX2 |KRE9 |MID2 |PIR1 |PIR3 |MORE
Regulation of Transcription	van den Brink J, et al. (2008) New insights into the Saccharomyces cerevisiae fermentation switch: dynamic transcriptional response to anaerobicity and glucose-excess. BMC Genomics 9:100	|ACE2 |ALG7 |ARE1 |AUS1 |BAS1 |DAL5 |DAN1 |DAN4 |DNF2 |FAA4 |FET4 |FHL1 |GCN4 |GLN3 |MORE
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Gorka-Niec W, et al. (2007) Protein glycosylation in pmt mutants of Saccharomyces cerevisiae. Influence of heterologously expressed cellobiohydrolase II of Trichoderma reesei and elevated levels of GDP-mannose and cis-prenyltransferase activity. Biochim Biophys Acta 1770(5):774-80	|PMT1 |PSA1 |RER2
Reviews	Goto M (2007) Protein o-glycosylation in fungi: diverse structures and multiple functions. Biosci Biotechnol Biochem 71(6):1415-27	|BAR1 |CTS1 |GAS1 |HSP150 |KEX2 |KRE2 |KRE9 |KTR1 |KTR3 |PMT1 |PMT3 |PMT4 |PMT5 |PMT6 |MORE
Computational analysis Protein-protein Interactions	Larsen P, et al. (2007) A statistical method to incorporate biological knowledge for generating testable novel gene regulatory interactions from microarray experiments. BMC Bioinformatics 8:317	|CDC45 |HEK2 |HHF1 |HHT1 |HSL1 |HTA1 |HTA2 |HTB1 |HTB2 |HTZ1 |KCC4 |MNN1 |PMT1 |PMT3 |MORE
Protein-Nucleic Acid Interactions RNA Levels and Processing	Oeffinger M, et al. (2007) Comprehensive analysis of diverse ribonucleoprotein complexes. Nat Methods 4(11):951-6	|ACB1 |ACT1 |ADE3 |AIM34 |ASH1 |ASM4 |BEM2 |BRR2 |BRX1 |BUD8 |CBC2 |CBF5 |CDC3 |CDC31 |MORE
Mutants/Phenotypes Strains/Constructs	Quan X, et al. (2007) The localization of nuclear exporters of the importin-beta family is regulated by Snf1 kinase, nutrient supply and stress. Biochim Biophys Acta 1773(7):1052-61	|BCK1 |CRM1 |CSE1 |LOS1 |MID2 |MKK1 |MKK2 |MSN5 |PKC1 |REG1 |ROM1 |SLG1 |SLT2 |SNF1
Fungal Related Genes/Proteins	Insenser M, et al. (2006) Proteomic analysis of detergent-resistant membranes from Candida albicans. Proteomics 6 Suppl 1:S74-81	|ATP2 |ECM33 |EFT1 |EFT2 |ERG11 |HSC82 |HXT6 |KRE2 |KTR1 |PET2 |PMA1 |POR1 |RPL16A |RPL4B |MORE
Reviews	Lehle L, et al. (2006) Protein glycosylation, conserved from yeast to man: a model organism helps elucidate congenital human diseases. Angew Chem Int Ed Engl 45(41):6802-18	|ALG1 |ALG11 |ALG12 |ALG13 |ALG14 |ALG2 |ALG3 |ALG5 |ALG6 |ALG7 |ALG8 |ALG9 |DIE2 |DPM1 |MORE
Mutants/Phenotypes Strains/Constructs	Serrano R, et al. (2006) Signaling alkaline pH stress in the yeast Saccharomyces cerevisiae through the Wsc1 cell surface sensor and the Slt2 MAPK pathway. J Biol Chem 281(52):39785-95	|BCK1 |CRH1 |DFG5 |GSC2 |IRC14 |PMT1 |SKT5 |SLG1 |SLT2 |SWI4 |SWI6
Cross-species Expression Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Strains/Constructs	Agaphonov MO, et al. (2005) Mutation of the protein-O-mannosyltransferase enhances secretion of the human urokinase-type plasminogen activator in Hansenula polymorpha. Yeast 22(13):1037-47	|PMT1
Function/Process Genetic Interactions	Schuldiner M, et al. (2005) Exploration of the function and organization of the yeast early secretory pathway through an epistatic miniarray profile. Cell 123(3):507-19	|ALG12 |ALG3 |ALG5 |ALG6 |ALG8 |ALG9 |API2 |APL5 |APL6 |APM3 |APS3 |ARL1 |ARL3 |ARV1 |MORE
Fungal Related Genes/Proteins	Tanaka N, et al. (2005) Characterization of O-mannosyltransferase family in Schizosaccharomyces pombe. Biochem Biophys Res Commun 330(3):813-20	|PMT1 |PMT4
Fungal Related Genes/Proteins	Willer T, et al. (2005) Protein O-mannosylation is crucial for cell wall integrity, septation and viability in fission yeast. Mol Microbiol 57(1):156-70	|PMT1 |PMT4
Function/Process Mutants/Phenotypes Strains/Constructs	Frieman MB and Cormack BP (2004) Multiple sequence signals determine the distribution of glycosylphosphatidylinositol proteins between the plasma membrane and cell wall in Saccharomyces cerevisiae. Microbiology 150(Pt 10):3105-14	|FLO1 |FLO9 |KRE2 |KTR1 |KTR3 |MNN1 |MNN9 |PMT1 |PMT3 |PMT4 |PMT5 |PMT6
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Lommel M, et al. (2004) Aberrant processing of the WSC family and Mid2p cell surface sensors results in cell death of Saccharomyces cerevisiae O-mannosylation mutants. Mol Cell Biol 24(1):46-57	|MID2 |PKC1 |PMT4 |SLG1 |SLT2 |WSC2
Genetic Interactions Strains/Constructs	Parsons AB, et al. (2004) Integration of chemical-genetic and genetic interaction data links bioactive compounds to cellular target pathways. Nat Biotechnol 22(1):62-9	|ARV1 |BEM1 |BEM2 |BRE1 |BRE2 |BTS1 |BUD25 |CAX4 |CHO2 |CIK1 |CIN1 |CIN2 |CIN4 |CLB3 |MORE
Genetic Interactions Strains/Constructs	Tong AH, et al. (2004) Global mapping of the yeast genetic interaction network. Science 303(5659):808-13	|AAD4 |AAH1 |ABF2 |ACE2 |ADH6 |AEP2 |AFG1 |AGP1 |AHC1 |AHC2 |AIM21 |AIM22 |AIM26 |AIM29 |MORE
Function/Process Mutants/Phenotypes Protein-protein Interactions Regulatory Role Substrates/Ligands/Cofactors	Ecker M, et al. (2003) O-mannosylation precedes and potentially controls the N-glycosylation of a yeast cell wall glycoprotein. EMBO Rep 4(6):628-32	|CIS3 |PMT1 |PMT4
Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Protein Sequence Features Protein-protein Interactions Protein/Nucleic Acid Structure Substrates/Ligands/Cofactors	Girrbach V and Strahl S (2003) Members of the evolutionarily conserved PMT family of protein O-mannosyltransferases form distinct protein complexes among themselves. J Biol Chem 278(14):12554-62	|PMT1 |PMT3 |PMT4 |PMT5
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Huang G, et al. (2003) Posttranslational modifications required for cell surface localization and function of the fungal adhesin Aga1p. Eukaryot Cell 2(5):1099-114	|AGA1 |PMT1
RNA Levels and Processing Regulation of	Jones DL, et al. (2003) Transcriptome profiling of a Saccharomyces cerevisiae mutant with a constitutively activated Ras/cAMP pathway. Physiol Genomics 16(1):107-18	|ACS1 |ADR1 |ALK1 |ARN1 |ATH1 |BUD19 |CAT8 |CCT7 |CCW12 |CHA4 |CHS2 |CTT1 |CUP5 |CYC7 |MORE
Fungal Related Genes/Proteins	Zakrzewska A, et al. (2003) cDNA encoding protein O-mannosyltransferase from the filamentous fungus Trichoderma reesei; functional equivalence to Saccharomyces cerevisiae PMT2. Curr Genet 43(1):11-6	|PMT4
Fungal Related Genes/Proteins	Shaw BD and Momany M (2002) Aspergillus nidulans polarity mutant swoA is complemented by protein O-mannosyltransferase pmtA. Fungal Genet Biol 37(3):263-70	|PMT3 |PMT6
Function/Process Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors	Harty C, et al. (2001) O-mannosylation protects mutant alpha-factor precursor from endoplasmic reticulum-associated degradation. Mol Biol Cell 12(4):1093-101	|SEC61
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors	Philip B and Levin DE (2001) Wsc1 and Mid2 are cell surface sensors for cell wall integrity signaling that act through Rom2, a guanine nucleotide exchange factor for Rho1. Mol Cell Biol 21(1):271-80	|MID2 |PKC1 |RHO1 |ROM2 |SLG1
Fungal Related Genes/Proteins Protein Sequence Features Protein-protein Interactions	Girrbach V, et al. (2000) Structure-function analysis of the dolichyl phosphate-mannose: protein O-mannosyltransferase ScPmt1p. J Biol Chem 275(25):19288-96	|PMT1 |PMT3 |PMT4 |PMT5 |PMT6
RNA Levels and Processing	Braley R and Chaffin WL (1999) Variations in mRNA transcript levels of cell wall-associated genes of Saccharomyces cerevisiae following spheroplasting. FEMS Microbiol Lett 181(1):177-85	|CRH1 |EGT2 |EXO1 |FLO1 |HKR1 |KRE1 |KRE11 |KRE5 |MSN1 |MUC1 |SEC53 |SED1 |SKT5 |TIR1
Function/Process Fungal Related Genes/Proteins	Romero PA, et al. (1999) Mnt2p and Mnt3p of Saccharomyces cerevisiae are members of the Mnn1p family of alpha-1,3-mannosyltransferases responsible for adding the terminal mannose residues of O-linked oligosaccharides. Glycobiology 9(10):1045-51	|MNN1 |MNT2 |MNT3 |MNT4 |PMT1 |PMT3 |PMT4 |PMT5 |PMT6
Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Protein-protein Interactions Strains/Constructs	Timpel C, et al. (1998) Multiple functions of Pmt1p-mediated protein O-mannosylation in the fungal pathogen Candida albicans. J Biol Chem 273(33):20837-46	|PMT1 |PMT3 |PMT4 |PMT5 |PMT6
Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors	Gentzsch M and Tanner W (1997) Protein-O-glycosylation in yeast: protein-specific mannosyltransferases. Glycobiology 7(4):481-6	|AGA2 |BAR1 |CTS1 |GAS1 |HSP150 |KEX2 |KRE9 |PMT1 |PMT3 |PMT4 |PMT5 |PMT6
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Finck M, et al. (1996) Defective threonine-linked glycosylation of human insulin-like growth factor in mutants of the yeast Saccharomyces cerevisiae. Glycobiology 6(3):313-20	|PMT1
Cellular Location Function/Process Fungal Related Genes/Proteins Mutants/Phenotypes Strains/Constructs Substrates/Ligands/Cofactors	Gentzsch M and Tanner W (1996) The PMT gene family: protein O-glycosylation in Saccharomyces cerevisiae is vital. EMBO J 15(21):5752-9	|GAS1 |PMT1 |PMT3 |PMT4 |PMT5 |PMT6 |PMT7
Fungal Related Genes/Proteins	Guerreiro P, et al. (1996) Sequencing of a 17.6 kb segment on the right arm of yeast chromosome VII reveals 12 ORFs, including CCT, ADE3 and TR-I genes, homologues of the yeast PMT and EF1G genes, of the human and bacterial electron-transferring flavoproteins (beta-chain) and of the Escherichia coli phosphoserine phosphohydrolase, and five new ORFs. Yeast 12(3):273-80	|ADE3 |CAM1 |CIR1 |ELP2 |MVB12 |PCT1 |PMT1 |PMT6 |SER2 |TDA10 |TEF4 |TRX2 |YCH1 |YGR201C |MORE
Function/Process Mutants/Phenotypes Protein-protein Interactions Strains/Constructs Techniques and Reagents	Gentzsch M, et al. (1995) Protein O-glycosylation in Saccharomyces cerevisiae: the protein O-mannosyltransferases Pmt1p and Pmt2p function as heterodimer. FEBS Lett 377(2):128-30	|PMT1
Function/Process Fungal Related Genes/Proteins Genetic Interactions Mutants/Phenotypes Protein Sequence Features Strains/Constructs	Immervoll T, et al. (1995) PMT3 and PMT4, two new members of the protein-O-mannosyltransferase gene family of Saccharomyces cerevisiae. Yeast 11(14):1345-51	|PMT1 |PMT3 |PMT4
Alias Function/Process Genetic Interactions Mapping Mutants/Phenotypes Strains/Constructs	Lussier M, et al. (1995) Protein O-glycosylation in yeast. The PMT2 gene specifies a second protein O-mannosyltransferase that functions in addition to the PMT1-encoded activity. J Biol Chem 270(6):2770-5	|PMT1
Alias Mutants/Phenotypes Strains/Constructs	Barton AB and Kaback DB (1994) Molecular cloning of chromosome I DNA from Saccharomyces cerevisiae: analysis of the genes in the FUN38-MAK16-SPO7 region. J Bacteriol 176(7):1872-80	|ATS1 |CCR4 |CYS3 |DEP1 |DRS2 |FUN26 |FUN30 |LTE1 |MAK16 |NTG1 |PSK1 |RAD16 |RAD54 |SPO7 |MORE

Return to SGD

Send a Message to the SGD Curators