---

• Site Map |
• Search Options |
• Help |
• Home |
•   |
•  

•  
• Community Info
• Submit Data
• BLAST
• Primers
• PatMatch
• Gene/Seq Resources
• Advanced Search
• Community Wiki

---

FUN26/YAL022C Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents

Names and Identifiers GO Annotations Pathways Summary Paragraph Mutant Phenotypes Interactions Homologs Protein Info (physical properties, transcript info) PDB Homologs (protein structure info) Motifs Genome-wide Expression (and other large-scale analyses) Locus History (misc. notes) Sequence Retrieval and Analysis Map and Displays Localization Community Annotation Literature Guide

Sequence Coordinates   ChrI: 110431 to 108878 CDS: 110431 - 108878 Click on map for expanded view SGD ORF map GBrowse

SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name	Systematic Name	Alias	Feature Type	SGDID
FUN26	YAL022C		ORF, Verified	S000000020
Description
Nucleoside transporter with broad nucleoside selectivity; localized to intracellular membranes

GO Annotations [TOP] [NEXT]
Molecular Function Annotation(s) Reference(s) Evidence Assigned By nucleoside transmembrane transporter activity Vickers MF, et al. (2000) Nucleoside transporter proteins of Saccharomyces cerevisiae. Demonstration of a transporter (FUI1) with high uridine selectivity in plasma membranes and a transporter (FUN26) with broad nucleoside selectivity in intracellular membranes. J Biol Chem 275(34):25931-8        IDA : Inferred from Direct Assay Assigned on 2002-09-19 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR002259 Assigned on 2007-05-23 UniProtKB
Biological Process Annotation(s) Reference(s) Evidence Assigned By nucleoside transport Vickers MF, et al. (2000) Nucleoside transporter proteins of Saccharomyces cerevisiae. Demonstration of a transporter (FUI1) with high uridine selectivity in plasma membranes and a transporter (FUN26) with broad nucleoside selectivity in intracellular membranes. J Biol Chem 275(34):25931-8        IDA : Inferred from Direct Assay Assigned on 2002-09-19 SGD transmembrane transport Vickers MF, et al. (2000) Nucleoside transporter proteins of Saccharomyces cerevisiae. Demonstration of a transporter (FUI1) with high uridine selectivity in plasma membranes and a transporter (FUN26) with broad nucleoside selectivity in intracellular membranes. J Biol Chem 275(34):25931-8        IDA : Inferred from Direct Assay Assigned on 2008-12-09 SGD transport DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR002259 Assigned on 2007-05-23 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0813 Assigned on 2007-05-23 UniProtKB
Cellular Component Annotation(s) Reference(s) Evidence Assigned By integral to membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0812 Assigned on 2007-05-23 UniProtKB GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.      IEA : Inferred from Electronic Annotation with EBI:SL-9909 Assigned on 2009-10-01 UniProtKB intracellular Vickers MF, et al. (2000) Nucleoside transporter proteins of Saccharomyces cerevisiae. Demonstration of a transporter (FUI1) with high uridine selectivity in plasma membranes and a transporter (FUN26) with broad nucleoside selectivity in intracellular membranes. J Biol Chem 275(34):25931-8        IDA : Inferred from Direct Assay Assigned on 2002-09-19 SGD membrane Vickers MF, et al. (2000) Nucleoside transporter proteins of Saccharomyces cerevisiae. Demonstration of a transporter (FUI1) with high uridine selectivity in plasma membranes and a transporter (FUN26) with broad nucleoside selectivity in intracellular membranes. J Biol Chem 275(34):25931-8        IDA : Inferred from Direct Assay Assigned on 2002-09-19 SGD DDB, et al. (2001) Gene Ontology annotation through association of InterPro records with GO terms.      IEA : Inferred from Electronic Annotation with EBI:IPR002259 Assigned on 2009-06-17 UniProtKB GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.      IEA : Inferred from Electronic Annotation with EBI:KW-0472 Assigned on 2009-06-29 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]

BASIC INFORMATION REFERENCES forFUN26/YAL022C for FUN26 1) Vickers MF, et al. (2000) Nucleoside transporter proteins of Saccharomyces cerevisiae. Demonstration of a transporter (FUI1) with high uridine selectivity in plasma membranes and a transporter (FUN26) with broad nucleoside selectivity in intracellular membranes. J Biol Chem 275(34):25931-8        2) Coleman KG, et al. (1986) Molecular cloning of chromosome I DNA from Saccharomyces cerevisiae: isolation and characterization of the CDC24 gene and adjacent regions of the chromosome. Mol Cell Biol 6(12):4516-25

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for FUN26/YAL022C

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for FUN26/YAL022C

Homologs [TOP] [NEXT]
Comparison Resources PSI-BLAST Results Ashbya Homologs (AGD) BLASTN vs. fungi BLASTP at NCBI BLASTP vs. fungi Candida Homologs (CGD) Candida Homologs (CandidaDB) Fungal Alignment Fungal Orthogroups Repository Ortholog Search (P-POD) PhylomeDB Synteny Viewer Yeast Gene Order Browser (YGOB) eukarYotic OrtholoGY (YOGY)

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]

Protein Sequence Calculations from Predicted Full length Translation N-term MSTSADT C-term IIDFIIR Length(aa) 517 MW(Da) 58,317 pI 4.79 Amino Acid Composition (full length) GCG tools: PepPlot, Helical Wheel, PepStruct Transcript Translation Calculations Codon Bias 0.078   Codon Adaptation Index 0.119   Frequency of Optimal Codons 0.461   Hydropathicity of Protein 0.263   Aromaticity Score 0.122

10 20 30 40 50 | | | | | MSTSADTDTIKKPILAVPEPALADTHSEEISRSGEEHESENNEHSDEEGD NYSEREQSVSTEPLDTLPLRKKLKNLSYITFFAIGIGLLWPWNCILSASQ YFKHDIFKDTSIWAKIFTSSMMSFSTISSMLFNIYLAKRQYKYSRRVING LVWEIIVFTVMCFFTILHFLLPKWFNFMFIMMLVVISSMGTAMTQNGIMA IANVFGSEYSQGVMVGQAVAGVLPSLVLFALAFIENSSVSTTGGILLYFF TTTLVVTICVVMFSVSKISRKVNENWNVEDGHITDVLLGSLRSNEEEIRI VGRIDQMEDEDHRRTNGTRDDNDEGEELQLKVPFEVLFAKLKYLVLSIFT TFVVTLVFPVFASATYVTGLPLSNAQYIPLIFTLWNLGDLYGRVIADWPM FRDQKFTPRKTFIYSLLRVAAIPLFLMFTAITSSSSGDEEHNGSVIVDLC YMLLQFLFGVTNGHVISMSFMKVPEQLDNDDEKEAAGGFTNIFVSTGLAL GSIISYVFVFIIDFIIR*

Protein Structures from PDB: proteins of known structure with sequence similarity to FUN26/YAL022C, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]
Functional Analysis Expression Connection Summary Cell cycle and metabolic oscillation Cell cycle transcript profile Cyclebase Genevestigator GermOnline SPELL Microarray Search YGAC Triples Yeast Microarray Global Viewer YeastFunc	You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]

Nomenclature History

Standard Name	Reference
FUN26	SGD (2007) Information without a citation in SGD

Sequence Retrieval [TOP] [NEXT]
Sequence Type	Output Format
Genomic DNA	GCG | FASTA | NoHeader
Genomic DNA with 1 kb up and downstream	GCG | FASTA | NoHeader
DNA coding sequence (without introns, without flanking regions)	GCG | FASTA | NoHeader
Protein Translation of ORF	GCG | FASTA | NoHeader
6-Frame Translation(with Restriction Map)	GCG
Restriction Fragment Sizes	GCG
Sequence Analysis Tools BLASTP BLASTN Design Primers FASTA aa FASTA nt Restriction Fragment Map Restriction Fragment Sizes Six-Frame Translation

Sequence from other databases
Sequence ID	Source
YAL022C	SGD Systematic Sequence
851211	NCBI: Gene ID
NP_009380.1	NCBI: RefSeq protein version ID
NP_009380.1	NCBI: RefSeq protein version ID
6319297	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps:	Chromosomal Feature Map	GBrowse	Combined Physical and Genetic Map	Genetic Distance vs. Physical Distance Ratios
Similarity Viewers:	Synteny Viewer	Genomic Stripe View	SAGE Results Map

Localization [TOP] [NEXT]
Localization Resources YGAC Triples YeastGFP DB (UCSF) at SGD

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics	Reference	Other Genes Addressed
11 curated references; 0 references not yet curated
Evolution Fungal Related Genes/Proteins	Hamari Z, et al. (2009) Convergent evolution and orphan genes in the Fur4p-like family and characterization of a general nucleoside transporter in Aspergillus nidulans. Mol Microbiol 73(1):43-57	|DAL4 |FCY2 |FCY21 |FCY22 |FUI1 |FUR4 |NRT1 |THI7 |THI72 |TPN1
Evolution Protein Sequence Features	Kelly L, et al. (2009) A survey of integral alpha-helical membrane proteins. J Struct Funct Genomics 10(4):269-80	|PDR18 |STE6
Genetic Interactions Mutants/Phenotypes Strains/Constructs	Lu SP, et al. (2009) Assimilation of Endogenous Nicotinamide Riboside Is Essential for Calorie Restriction-mediated Life Span Extension in Saccharomyces cerevisiae. J Biol Chem 284(25):17110-9	|BNA6 |NMA1 |NMA2 |NPP1 |NPP2 |NPT1 |NRK1 |NRT1 |PHO5 |PNC1 |PNP1 |QNS1 |SIR2 |TNA1 |MORE
Cellular Location	Wiederhold E, et al. (2009) The yeast vacuolar membrane proteome. Mol Cell Proteomics 8(2):380-92	|ADP1 |AKR2 |APE3 |APL5 |APM3 |AVT1 |AVT3 |AVT7 |CPS1 |DAP2 |ECM14 |ENO2 |FMP42 |FRE6 |MORE
Function/Process Genetic Interactions Mutants/Phenotypes Strains/Constructs	Belenky PA, et al. (2008) Saccharomyces cerevisiae YOR071C Encodes the High Affinity Nicotinamide Riboside Transporter Nrt1. J Biol Chem 283(13):8075-9	|NRT1
Function/Process Mutants/Phenotypes	Hancock LC, et al. (2006) Genomic analysis of the Opi- phenotype. Genetics 173(2):621-34	|AGE2 |ALG9 |APL5 |APL6 |APM3 |APS3 |ARC18 |BSD2 |CHO2 |CKB2 |DEP1 |DID4 |EAF1 |EAF3 |MORE
Protein-protein Interactions	Millson SH, et al. (2005) A two-hybrid screen of the yeast proteome for Hsp90 interactors uncovers a novel Hsp90 chaperone requirement in the activity of a stress-activated mitogen-activated protein kinase, Slt2p (Mpk1p). Eukaryot Cell 4(5):849-60	|ACF4 |ACT1 |AGP2 |AHA1 |AIM2 |AIM37 |ANT1 |AQR1 |ARE1 |ARE2 |ARG4 |ARR3 |ASG7 |ATG14 |MORE
Mutants/Phenotypes	Willingham S, et al. (2003) Yeast genes that enhance the toxicity of a mutant huntingtin fragment or alpha-synuclein. Science 302(5651):1769-72	|ABZ2 |AIM46 |ALB1 |APE2 |APJ1 |APM2 |ARL3 |ARO1 |ATG15 |AYR1 |CIT2 |CMK1 |COG6 |COS111 |MORE
Cellular Location Function/Process Mutants/Phenotypes Non-Fungal Related Genes/Proteins Strains/Constructs Techniques and Reagents	Vickers MF, et al. (2000) Nucleoside transporter proteins of Saccharomyces cerevisiae. Demonstration of a transporter (FUI1) with high uridine selectivity in plasma membranes and a transporter (FUN26) with broad nucleoside selectivity in intracellular membranes. J Biol Chem 275(34):25931-8	|FUI1
Non-Fungal Related Genes/Proteins	Griffiths M, et al. (1997) Cloning of a human nucleoside transporter implicated in the cellular uptake of adenosine and chemotherapeutic drugs. Nat Med 3(1):89-93
Mutants/Phenotypes RNA Levels and Processing	Barton AB and Kaback DB (1994) Molecular cloning of chromosome I DNA from Saccharomyces cerevisiae: analysis of the genes in the FUN38-MAK16-SPO7 region. J Bacteriol 176(7):1872-80	|ATS1 |CCR4 |CYS3 |DEP1 |DRS2 |FUN30 |LTE1 |MAK16 |NTG1 |PMT2 |PSK1 |RAD16 |RAD54 |SPO7 |MORE

Return to SGD

Send a Message to the SGD Curators