SPO7/YAL009W Single Page Format

This page provides an alternative format to the SGD Locus Summary Page. Note that additional information may be available on or linked from the standard format SGD Locus Summary page.

Contents
Names and Identifiers

GO Annotations

Pathways

Summary Paragraph

Mutant Phenotypes

Interactions

Homologs

Protein Info (physical properties, transcript info)

PDB Homologs (protein structure info)

Motifs

Genome-wide Expression
(and other large-scale analyses)

Locus History (misc. notes)

Sequence Retrieval and Analysis

Map and Displays

Localization

Community Annotation

Literature Guide

Sequence Coordinates

ChrI: 135856 to 136635
CDS: 135856 - 136635
Genetic position: -4 cM
Genetic Map Data

Click on map for expanded view

SGD ORF map GBrowse
SGD Locus Page

Names and Identifiers [TOP] [NEXT]
Standard Name Systematic Name Alias Feature Type SGDID

SPO7 YAL009W ORF, Verified S000000007

Description
Putative regulatory subunit of Nem1p-Spo7p phosphatase holoenzyme, regulates nuclear growth by controlling phospholipid biosynthesis, required for normal nuclear envelope morphology, premeiotic replication, and sporulation

GO Annotations [TOP] [NEXT]
Molecular Function
Annotation(s) Reference(s) Evidence Assigned By
contributes_to phosphoprotein phosphatase activity Santos-Rosa H, et al. (2005) The yeast lipin Smp2 couples phospholipid biosynthesis to nuclear membrane growth. EMBO J 24(11):1931-41
         IDA : Inferred from Direct Assay
Assigned on 2007-05-07 SGD
Biological Process
Annotation(s) Reference(s) Evidence Assigned By
ascospore formation Siniossoglou S, et al. (1998) A novel complex of membrane proteins required for formation of a spherical nucleus. EMBO J 17(22):6449-64
       IMP : Inferred from Mutant Phenotype
Assigned on 2002-10-02 SGD
meiosis Esposito MS and Esposito RE (1974) Genes controlling meiosis and spore formation in yeast. Genetics 78(1):215-25
     IMP : Inferred from Mutant Phenotype
Assigned on 2002-10-02 SGD
nuclear envelope organization Siniossoglou S, et al. (1998) A novel complex of membrane proteins required for formation of a spherical nucleus. EMBO J 17(22):6449-64
       IMP : Inferred from Mutant Phenotype
Assigned on 2009-01-26 SGD
regulation of lipid biosynthetic process Santos-Rosa H, et al. (2005) The yeast lipin Smp2 couples phospholipid biosynthesis to nuclear membrane growth. EMBO J 24(11):1931-41
         IGI : Inferred from Genetic Interaction with SGD:PAH1
Assigned on 2009-01-26 SGD
sporulation resulting in formation of a cellular spore GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0749
Assigned on 2007-05-23 UniProtKB
Cellular Component
Annotation(s) Reference(s) Evidence Assigned By
endoplasmic reticulum GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0256
Assigned on 2007-05-23 UniProtKB
integral to membrane Siniossoglou S, et al. (1998) A novel complex of membrane proteins required for formation of a spherical nucleus. EMBO J 17(22):6449-64
       IDA : Inferred from Direct Assay
ISM : Inferred from Sequence Model
Assigned on 2002-10-02 SGD
GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0812
Assigned on 2007-05-23 UniProtKB
GOA curators and UniProt curators (2007) Gene Ontology annotation based on Swiss-Prot Subcellular Location vocabulary mapping.
     IEA : Inferred from Electronic Annotation with EBI:SL-9909
Assigned on 2009-10-01 UniProtKB
membrane GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0472
Assigned on 2007-05-23 UniProtKB
nuclear envelope-endoplasmic reticulum network Siniossoglou S, et al. (1998) A novel complex of membrane proteins required for formation of a spherical nucleus. EMBO J 17(22):6449-64
       IDA : Inferred from Direct Assay
Assigned on 2002-10-02 SGD
nucleus GOA curators (2000) Gene Ontology annotation based on Swiss-Prot keyword mapping.
     IEA : Inferred from Electronic Annotation with EBI:KW-0539
Assigned on 2007-05-23 UniProtKB

Pathways [TOP] [NEXT]
No pathways available

Summary Paragraph [TOP] [NEXT]
No summary paragraph available

Basic References [TOP]
BASIC INFORMATION REFERENCES forSPO7/YAL009W for SPO7
1) Siniossoglou S, et al. (1998) A novel complex of membrane proteins required for formation of a spherical nucleus. EMBO J 17(22):6449-64

2) Esposito MS and Esposito RE (1974) Genes controlling meiosis and spore formation in yeast. Genetics 78(1):215-25

3) Santos-Rosa H, et al. (2005) The yeast lipin Smp2 couples phospholipid biosynthesis to nuclear membrane growth. EMBO J 24(11):1931-41

4) Esposito, R.E. and Waddell, C. (1985) Personal Communication, Mortimer Map Edition 9

Mutant Phenotypes [TOP] [NEXT]
Phenotype page for SPO7/YAL009W

Interactions: genetic, physical, and other gene-gene links. [TOP] [NEXT]
Interaction page for SPO7/YAL009W

Homologs [TOP] [NEXT]

Comparison Resources

Physical Properties and Transcript Information: predicted from sequence [TOP] [NEXT]
Protein Sequence Calculations
from Predicted Full length Translation

N-term MEPESIG

C-term ELRPKSE

Length(aa) 259

MW(Da) 30,113

pI 10.84

Amino Acid Composition (full length)

GCG tools: PepPlot, Helical Wheel, PepStruct

Transcript Translation Calculations

Codon Bias 0.030

Codon Adaptation Index 0.111

Frequency of Optimal Codons 0.424

Hydropathicity of Protein -0.321

Aromaticity Score 0.120

10 20 30 40 50 | | | | | MEPESIGDVGNHAQDDSASIVSGPRRRSTSKTSSAKNIRNSSNISPASMI FRNLLILEDDLRRQAHEQKILKWQFTLFLASMAGVGAFTFYELYFTSDYV KGLHRVILQFTLSFISITVVLFHISGQYRRTIVIPRRFFTSTNKGIRQFN VKLVKVQSTWDEKYTDSVRFVSRTIAYCNIYCLKKFLWLKDDNAIVKFWK SVTIQSQPRIGAVDVKLVLNPRAFSAEIREGWEIYRDEFWAREGARRRKQ AHELRPKSE*

Protein Structures from PDB: proteins of known structure with sequence similarity to SPO7/YAL009W, based on Smith-Waterman analysis. [TOP] [NEXT]
No protein structure information available.

Genome-wide Expression and Other Large-Scale Analyses [TOP] [NEXT]

Functional Analysis
You can also search multiple datasets simultaneously using Expression Connection for expression studies or Function Junction for other large scale analyses.

Locus History (misc. notes) [TOP] [NEXT]
Nomenclature History
Standard Name Reference
SPO7 Esposito, R.E. and Waddell, C. (1985) Personal Communication, Mortimer Map Edition 9

Standard Name	Reference
SPO7	Esposito, R.E. and Waddell, C. (1985) Personal Communication, Mortimer Map Edition 9

Sequence Retrieval [TOP] [NEXT]
Sequence Type Output Format

Genomic DNA GCG | FASTA | NoHeader

Genomic DNA with 1 kb up and downstream GCG | FASTA | NoHeader

DNA coding sequence
(without introns, without flanking regions) GCG | FASTA | NoHeader

Protein Translation of ORF GCG | FASTA | NoHeader

6-Frame Translation(with Restriction Map) GCG

Restriction Fragment Sizes GCG

Sequence Analysis Tools
Sequence from other databases

Sequence ID Source

YAL009W SGD Systematic Sequence

851224 NCBI: Gene ID

NP_009393.1 NCBI: RefSeq protein version ID

NP_009393.1 NCBI: RefSeq protein version ID

6319310 NCBI: NCBI protein GI

Sequence from other databases
Sequence ID	Source
YAL009W	SGD Systematic Sequence
851224	NCBI: Gene ID
NP_009393.1	NCBI: RefSeq protein version ID
NP_009393.1	NCBI: RefSeq protein version ID
6319310	NCBI: NCBI protein GI

Map and Displays [TOP] [NEXT]
Physical, Genetic Maps: Chromosomal Feature Map GBrowse Combined Physical and Genetic Map Genetic Distance vs. Physical Distance Ratios
Similarity Viewers: Synteny Viewer Genomic Stripe View SAGE Results Map

Localization [TOP] [NEXT]

Localization Resources

Community Annotation [TOP] [NEXT]
No community annotation available.

Literature Guide: papers categorized by topic. [TOP]
Topics Reference Other Genes Addressed
26 curated references; 0 references not yet curated
Genetic Interactions
Mutants/Phenotypes
Hodg CA, et al. (2010) Integral membrane proteins Brr6 and Apq12 link assembly of the nuclear pore complex to lipid homeostasis in the endoplasmic reticulum. J Cell Sci 123(Pt 1):141-151
       |ACC1 |APQ12 |ARE1 |ARE2 |ARV1 |BRR6 |DGA1 |ELO1 |ERG2 |ERG3 |ERG4 |ERG5 |ERG6 |FEN1 |MORE
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Dawson TR, et al. (2009) ER membrane-bending proteins are necessary for de novo nuclear pore formation. J Cell Biol 184(5):659-75
       |GLE2 |NEM1 |NIC96 |NUP116 |NUP120 |NUP133 |NUP145 |NUP188 |NUP49 |NUP82 |NUP84 |NUP85 |POM152 |POM34 |MORE
Genetic Interactions
Federovitch CM, et al. (2008) Genetic and structural analysis of Hmg2p-induced endoplasmic reticulum remodeling in Saccharomyces cerevisiae. Mol Biol Cell 19(10):4506-20
       |BNI1 |BNR1 |CHO2 |ERG28 |ERV25 |HER1 |HER2 |HMG1 |HMG2 |HOF1 |HRD1 |KAR2 |NEM1 |OPI3 |MORE
Genetic Interactions
Han GS, et al. (2008) An unconventional diacylglycerol kinase that regulates phospholipid synthesis and nuclear membrane growth. J Biol Chem 283(29):20433-42
       |CDS1 |CHO2 |DGK1 |GAT2 |NEM1 |OPI3 |PAH1 |PSD1
Computational analysis
Mutants/Phenotypes
Protein-protein Interactions
Schluter C, et al. (2008) Global Analysis of Yeast Endosomal Transport Identifies the Vps55/68 Sorting Complex. Mol Biol Cell 19(4):1282-1294
       |AKR1 |ARF1 |ARP5 |ARP6 |BRO1 |BUD32 |CDC50 |COG5 |COG6 |COG7 |COG8 |CUP5 |DID4 |EAF1 |MORE
Cellular Location
Chen SC, et al. (2007) Automated image analysis of protein localization in budding yeast. Bioinformatics 23(13):i66-71
       |YFL034W |YGR130C
Protein Processing/Modification/Regulation
Lee MW, et al. (2007) Global protein expression profiling of budding yeast in response to DNA damage. Yeast 24(3):145-54
           |ACK1 |ANB1 |AQY2 |ASF1 |ASK1 |ATG16 |ATP7 |BER1 |CBP4 |CDC1 |CDC25 |CWC24 |FET4 |HIR3 |MORE
Mutants/Phenotypes
Strains/Constructs
Lockshon D, et al. (2007) The sensitivity of yeast mutants to oleic Acid implicates the peroxisome and other processes in membrane function. Genetics 175(1):77-91
       |ADO1 |ADR1 |AIM38 |AKR1 |ARP6 |ATG17 |AVL9 |BUD14 |BUD22 |BUD23 |BUD31 |CAR2 |CBS1 |CLA4 |MORE
Mutants/Phenotypes
Campbell JL, et al. (2006) Yeast nuclear envelope subdomains with distinct abilities to resist membrane expansion. Mol Biol Cell 17(4):1768-78
       |MLP1 |NSR1
Substrates/Ligands/Cofactors
O'Hara L, et al. (2006) Control of phospholipid synthesis by phosphorylation of the yeast lipin Pah1p/Smp2p Mg2+-dependent phosphatidate phosphatase. J Biol Chem 281(45):34537-48
       |INO1 |NEM1 |OPI1 |OPI3 |PAH1
Strains/Constructs
Reggiori F and Klionsky DJ (2006) Atg9 sorting from mitochondria is impaired in early secretion and VFT-complex mutants in Saccharomyces cerevisiae. J Cell Sci 119(Pt 14):2903-11
       |ATG1 |ATG9 |SEC12 |SED5 |VPS4 |VPS51 |VPS52 |VPS53 |VPS54
Function/Process
Genetic Interactions
Mutants/Phenotypes
Regulatory Role
Strains/Constructs
Substrates/Ligands/Cofactors
Santos-Rosa H, et al. (2005) The yeast lipin Smp2 couples phospholipid biosynthesis to nuclear membrane growth. EMBO J 24(11):1931-41
         |CDC28 |NEM1 |PAH1
Mutants/Phenotypes
Strains/Constructs
Kushner DB, et al. (2003) Systematic, genome-wide identification of host genes affecting replication of a positive-strand RNA virus. Proc Natl Acad Sci U S A 100(26):15764-9
           |ACB1 |ALF1 |AML1 |BRO1 |BUB1 |BUD26 |BUD31 |CBC2 |CDC50 |DBR1 |DED1 |DHH1 |DOA1 |DOA4 |MORE
Mutants/Phenotypes
Strains/Constructs
Fleming JA, et al. (2002) Complementary whole-genome technologies reveal the cellular response to proteasome inhibition by PS-341. Proc Natl Acad Sci U S A 99(3):1461-6
             |APN1 |ATG17 |BEM4 |BIK1 |CCR4 |CDC26 |CHL1 |CHL4 |CLB2 |CLB5 |CSM3 |CTF19 |CTF8 |DCC1 |MORE
Cellular Location
Function/Process
Genetic Interactions
Mutants/Phenotypes
Protein-protein Interactions
Strains/Constructs
Siniossoglou S, et al. (1998) A novel complex of membrane proteins required for formation of a spherical nucleus. EMBO J 17(22):6449-64
       |NEM1 |NUP84
Mapping
Strains/Constructs
Barton AB and Kaback DB (1994) Molecular cloning of chromosome I DNA from Saccharomyces cerevisiae: analysis of the genes in the FUN38-MAK16-SPO7 region. J Bacteriol 176(7):1872-80
     |ATS1 |CCR4 |CYS3 |DEP1 |DRS2 |FUN26 |FUN30 |LTE1 |MAK16 |NTG1 |PMT2 |PSK1 |RAD16 |RAD54 |MORE
DNA/RNA Sequence Features
Mapping
Strains/Constructs
Clark MW, et al. (1994) Sequencing of chromosome I of Saccharomyces cerevisiae: analysis of the 42 kbp SPO7-CENI-CDC15 region. Yeast 10(4):535-41
     |CDC15 |CEN1 |EFB1 |MDM10
DNA/RNA Sequence Features
Mapping
Strains/Constructs
Ouellette BF, et al. (1993) Sequencing of chromosome I from Saccharomyces cerevisiae: analysis of a 32 kb region between the LTE1 and SPO7 genes. Genome 36(1):32-42
     |DEP1 |LTE1
Mapping
Strains/Constructs
Malvar T, et al. (1992) The CCR4 protein from Saccharomyces cerevisiae contains a leucine-rich repeat region which is required for its control of ADH2 gene expression. Genetics 132(4):951-62
     |ADH2 |CCR4 |HIS4 |SPT10 |SPT6
DNA/RNA Sequence Features
Mapping
Protein Sequence Features
RNA Levels and Processing
Strains/Constructs
Whyte W, et al. (1990) Molecular cloning of chromosome I DNA from Saccharomyces cerevisiae: isolation, characterization and regulation of the SPO7 sporulation gene. Gene 95(1):65-72

Regulatory Role
Kao G, et al. (1989) Dependence of inessential late gene expression on early meiotic events in Saccharomyces cerevisiae. Mol Gen Genet 215(3):490-500
     |CDC8 |CDC9 |RAD50 |RAD57 |SPO13 |SPR3
Fungal Related Genes/Proteins
Smith LM, et al. (1988) Identification and characterization of mutations affecting sporulation in Saccharomyces cerevisiae. Genetics 120(4):899-907
     |IME4 |SPO1 |SPO17 |SPO9 |SSP1
Mapping
Strains/Constructs
Wickner RB, et al. (1987) Molecular cloning of chromosome I DNA from Saccharomyces cerevisiae: isolation of the MAK16 gene and analysis of an adjacent gene essential for growth at low temperatures. Yeast 3(1):51-7
     |LTE1 |MAK16 |MKT1
Function/Process
Mutants/Phenotypes
Esposito MS, et al. (1975) Antimutator activity during mitosis by a meiotic mutant of yeast. Mol Gen Genet 139(1):9-18

Function/Process
Fungal Related Genes/Proteins
Esposito MS and Esposito RE (1974) Genes controlling meiosis and spore formation in yeast. Genetics 78(1):215-25
     |IME4 |SPO10 |SPO4 |SPO5 |SPO9 |SSP1
Genetic Interactions
Mutants/Phenotypes
Strains/Constructs
Esposito RE, et al. (1972) The genetic control of sporulation in Saccharomyces. II. Dominance and complementation of mutants of meiosis and spore formation. Mol Gen Genet 114(3):241-8
     |IME4 |SPO1 |SPO10 |SPO11 |SPO4 |SPO5 |SPO9 |SSP1

Return to SGD

SGD^tm pages Database Copyright © 1997-2010 The Board of Trustees of Leland Stanford Junior University. Permission to use the information contained in this database was given by the researchers/institutes who contributed or published the information. Users of the database are solely responsible for compliance with any copyright restrictions, including those applying to the author abstracts. Documents from this server are provided "AS-IS" without any warranty, expressed or implied. The SGD project at Stanford University is supported by a Genome Research Resource Grant from the US National Human Genome Research Institute, part of the US National Institutes of Health.