Take our Survey

Alignment of YPR137C-B and PDB 3S3N (chain B) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein YPR137C-B. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene YPR137C-B and PDB protein 3S3N (chain B)Jump to
Structure
Alignment Details
YPR137C-B length = 1756 aaAlignment Length = 201 aa (11.4%)P-value = 1.5e-05%Identity = 27%Similar = 16
Alignment Position

Sequence Alignment

YPR137C-B

636

QCPDCLIGKSTKHRHIKGSRLKYQNSYEPFQYLHTDIFGPVHNLPKSAPSYFISFTDETT

695






+C CLI ++ G L+ +PF D GP+ P Y + D T


3S3N_(B)

98

RCQQCLITNASNKA--SGPILRPDRPQKPFDKFFIDYIGPLP--PSQGYLYVLVVVDGMT

153

YPR137C-B

696

KFRWVYPLHDRREDSI---LDVFTTILAFIKNQFQASVLVIQMDRGSEYTNRTLHKFLEK

752






F W+YP + L+V T+I A K VI D+G+ +T+ T ++ ++


3S3N_(B)

154

GFTWLYPTKAPSTSATVKSLNVLTSI-AIPK--------VIHSDQGAAFTSSTFAEWAKE

204

YPR137C-B

753

NGITPCYTTTADSRAHGVAERLNRTLLDDCRTQLQCSGLPNHLWFSAIEFSTIVRNSLAS

812






GI ++T ++HG ER N + T+L G P W+ + + N+ S


3S3N_(B)

205

RGIHLEFSTPYHPQSHGKVERKNSDI-KRLLTKLLV-GRPTK-WYDLLPVVQLALNNTYS

261

YPR137C-B

813

PKSKKSARQHAGLAGLDISTLLPF

836






P K + H L G+D +T PF


3S3N_(B)

262

PVLKYTP--HQLLFGIDSNT--PF

281

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3S3N (Chain B)
Crystal Structure Of The Prototype Foamy Virus (Pfv) S217h Mutant Intasome In Complex With Magnesium And Dolutegravir (SGSK1349572)
  • PDB_Info
  • Homolog SourceHuman spumaretrovirus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05