Alignment of ARP7/YPR034W and PDB 2P9U (chain B) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein ARP7/YPR034W. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene ARP7/YPR034W and PDB protein 2P9U (chain B)Jump to
Structure
Alignment Details
ARP7 length = 478 aaAlignment Length = 182 aa (38.1%)P-value = 5.0e-05%Identity = 22%Similar = 21
Alignment Position

Sequence Alignment

ARP7

5

RKCVVIHNGSHRTVAGFSNVELPQCIIPS----SYIKRTDEGGEAEFIFGTYNMIDAAAE

60






RK VV NG+ G++ P+ I P+ I+ T + G E + D A+E


2P9U_(B)

6

RKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEI--KDLMVGDEASE

63

ARP7

61

KRNGDEVYTLVDSQGLPYNWDALEMQWRYLYDTQ-LKVSPEELPLVITMPATNGKPDMAI

119






R+ EV +++ G+ NWD ++ W Y + + L + +++T P N +


2P9U_(B)

64

LRSMLEVNYPMEN-GIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNR--

120

ARP7

120

LERYYELAFDKLNVPVFQIVIEPLAIALSMGKSSAFVIDIGASGCNVTPIIDGIVVKNAV

179






E+ E+ F+ + I+ + + G + V+D G ++ P+ +G + +


2P9U_(B)

121

-EKIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLT

179

ARP7

180

VRSKFGG

186






R G


2P9U_(B)

180

RRLDIAG

186

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein2P9U (Chain B)
Crystal Structure Of Bovine Arp23 COMPLEX CO-Crystallized With Amp-Pnp And Calcium
  • PDB_Info
  • Homolog SourceBos taurus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-12-05