Take our Survey

Alignment of ARP7/YPR034W and PDB 1O19 (chain 2) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein ARP7/YPR034W. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene ARP7/YPR034W and PDB protein 1O19 (chain 2)Jump to
Structure
Alignment Details
ARP7 length = 478 aaAlignment Length = 184 aa (38.5%)P-value = 2.3e-12%Identity = 25%Similar = 22
Alignment Position

Sequence Alignment

ARP7

8

VVIHNGSHRTVAGFSNVELPQCIIPSSYIKRTDEGGEAEFIFGTYNMIDAAAEKRNGDEV

67






+V NGS AGF+ + P+ + PS + R G + + + A+ + G


1O19_(2)

8

LVCDNGSGLVKAGFAGDDAPRAVFPS-IVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT

66

ARP7

68

YTLVDSQGLPYNWDALEMQWRYLYDTQLKVSPEELPLVITMPATNGKPDMAILERYYELA

127






G+ NWD +E W + + +L+V+PEE P ++T N K + E+ ++


1O19_(2)

67

LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANR---EKMTQIM

123

ARP7

128

FDKLNVPVFQIVIEPLAIALSMGKSSAFVIDIGASGCNVTPIIDGIVVKNAVVRSKFGG-

186






F+ NVP + I+ + + G+++ V+D G + PI +G + +A++R G


1O19_(2)

124

FETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGR

183

ARP7

187

DFLDF

191






D D+


1O19_(2)

184

DLTDY

188

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein1O19 (Chain 2)
Molecular Models Of Averaged Rigor Crossbridges From Tomograms Of Insect Flight Muscle
  • PDB_Info
  • Homolog SourceOryctolagus cuniculus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05