Alignment of YPL257W-B and PDB 3OYA (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein YPL257W-B. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene YPL257W-B and PDB protein 3OYA (chain A)Jump to
Structure
Alignment Details
YPL257W-B length = 1756 aaAlignment Length = 201 aa (11.4%)P-value = 0.000120%Identity = 26%Similar = 17
Alignment Position

Sequence Alignment

YPL257W-B

636

QCPDCLIGKSTKHRHIKGSRLKYQNSYEPFQYLHTDIFGPVHNLPNSAPSYFISFTDETT

695






+C CLI ++ G L+ +PF D GP+ P+ Y + D T


3OYA_(A)

98

RCQQCLITNASNKA--SGPILRPDRPQKPFDKFFIDYIGPLP--PSQGYLYVLVVVDGMT

153

YPL257W-B

696

KFRWVYPLHDRREDSI---LDVFTTILAFIKNQFQASVLVIQMDRGSEYTNRTLHKFLEK

752






F W+YP + L+V T+I A K VI D+G+ +T+ T ++ ++


3OYA_(A)

154

GFTWLYPTKAPSTSATVKSLNVLTSI-AIPK--------VIHSDQGAAFTSSTFAEWAKE

204

YPL257W-B

753

NGITPCYTTTADSRAHGVAERLNRTLLDDCRTQLQCSGLPNHLWFSAIEFSTIVRNSLAS

812






GI ++T ++ G ER N + T+L G P W+ + + N+ S


3OYA_(A)

205

RGIHLEFSTPYHPQSSGKVERKNSDI-KRLLTKLLV-GRPTK-WYDLLPVVQLALNNTYS

261

YPL257W-B

813

PKSKKSARQHAGLAGLDISTLLPF

836






P K + H L G+D +T PF


3OYA_(A)

262

PVLKYTP--HQLLFGIDSNT--PF

281

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3OYA (Chain A)
Crystal Structure Of The Prototype Foamy Virus (Pfv) Intasome In Complex With Magnesium And Raltegravir At 2.65 Resolution
  • PDB_Info
  • Homolog SourceHuman spumaretrovirus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05