Take our Survey

Alignment of ALD6/YPL061W and PDB 3RHJ (chain C) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein ALD6/YPL061W. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene ALD6/YPL061W and PDB protein 3RHJ (chain C)Jump to
Structure
Alignment Details
ALD6 length = 501 aaAlignment Length = 479 aa (95.6%)P-value = 2.1e-101%Identity = 42%Similar = 19
Alignment Position

Sequence Alignment

ALD6

18

NGLTYEQPTGLFINNKFMKAQDGKTYPVEDPSTENTVCEVSSATTEDVEYAIECADRAFH

77






N LT + P LFI +F+ A+ KTY +P+ + +C+VS A DV+ A+ A AF


3RHJ_(C)

29

NKLTLQMPYQLFIGGEFVDAEGSKTYNTINPTDGSVICQVSLAQVSDVDKAVAAAKEAFE

88

ALD6

78

DTEWATQDPRERGRLLSKLADELESQIDLVSSIEALDNGKTLALA-RGDVTIAINCLRDA

136






+ W + R+RGRLL +LAD +E + +++IEALD G LA + V ++I R


3RHJ_(C)

89

NGLWGKINARDRGRLLYRLADVMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYF

148

ALD6

137

AAYADKVNGRTINTGDGYMN----FTTLEPIGVCGQIIPWNFPIMMLAWKIAPALAMGNV

192






A + DK+ G TI N T EP+GVCG +IPWN+P+MML+WK A LA GN


3RHJ_(C)

149

AGWCDKIQGATIPINQARPNRNLTLTKKEPVGVCGIVIPWNYPLMMLSWKTAACLAAGNT

208

ALD6

193

CILKPAAVTPLNALYFASLCKKVGIPAGVVNIVPGPGRTVGAALTNDPRIRKLAFTGSTE

252






++KPA VTPL AL FA L K GIP GVVNI+PG G VG L++ P +RK+ FTGSTE


3RHJ_(C)

209

VVIKPAQVTPLTALKFAELTLKAGIPKGVVNILPGSGSLVGQRLSDHPDVRKIGFTGSTE

268

ALD6

253

VGKSVAVDSSESNLKKITLELGGKSAHLVFDDANIKKTLPNLVNGIFKNAGQICSSGSRI

312






VGK + + SN+KK++L LGGKS ++F D ++ K + ++ +F N G+ C + R+


3RHJ_(C)

269

VGKHIMKSCALSNVKKVSLALGGKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRL

328

ALD6

313

YVQEGIYDELLAAFKAYLETEIKVGNPFDKANFQGAITNRQQFDTIMNYIDIGKKEGAKI

372






+V+E I+++ + +E ++K+GNP ++ G + ++ Y G KEGA +


3RHJ_(C)

329

FVEESIHNQFVQKVVEEVE-KMKIGNPLERDTNHGPQNHEAHLRKLVEYCQRGVKEGATL

387

ALD6

373

LTGGEKVGDKGYFIRPTVFYDVNEDMRIVKEEIFGPVVTVAKFKT--LEEGVEMANSSEF

430






+ GG +V G+F +PTVF DV + M I KEE FGP++ +++F ++ + AN++EF


3RHJ_(C)

388

VCGGNQVPRPGFFFQPTVFTDVEDHMYIAKEESFGPIMIISRFADGDVDAVLSRANATEF

447

ALD6

431

GLGSGIETESLSTGLKVAKMLKAGTVWINTYNDFDSRVPFGGVKQSGYGREMGEEVYHAY

490






GL SG+ T ++ L V+ L+AGTV+INTYN D PFGG KQSG+G+++GE + Y


3RHJ_(C)

448

GLASGVFTRDINKALYVSDKLQAGTVFINTYNKTDVAAPFGGFKQSGFGKDLGEAALNEY

507

ALD6

491

TEVKAV

496






+K V


3RHJ_(C)

508

LRIKTV

513

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3RHJ (Chain C)
Crystal Structure Of The E673a Mutant Of The C-Terminal Domain Of Rat 10'formyltetrahydrofolate Dehydrogenase In Complex With Co-Purified Nadp
  • PDB_Info
  • Homolog SourceRattus norvegicus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05