Alignment of PRE10/YOR362C and PDB 3C92 (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein PRE10/YOR362C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene PRE10/YOR362C and PDB protein 3C92 (chain A)Jump to
Structure
Alignment Details
PRE10 length = 289 aaAlignment Length = 202 aa (69.9%)P-value = 1.8e-31%Identity = 38%Similar = 20
Alignment Position

Sequence Alignment

PRE10

8

YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNVKI

67






YD + +VFSPDGR FQVEYA +AV+ G+T++G+K +GV+ +K + S+L+ KI


3C92_(A)

8

YDRAITVFSPDGRLFQVEYAREAVKKGSTALGMKFANGVLLISDKKVRSRLIEQNSIEKI

67

PRE10

68

QVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLYN

127






Q++D ++ V SGL+ D R LV+ R A K Y + + I R+ +Q +T Y


3C92_(A)

68

QLIDDYVAAVTSGLVADARVLVDFARISAQQEKVTYGSLVNIENLVKRVADQMQQYTQYG

127

PRE10

128

SVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDHHPEGL

187






VRP+GVS IF G+D+ G L+ +P+G+ YK A G G+ + + LE+ + E L


3C92_(A)

128

GVRPYGVSLIFAGIDQIGPRLFDCDPAGTINEYKATAIGSGKDAVVSFLER---EYKENL

184

PRE10

188

SAREAVKQAAKIIYLAHEDNKE

209






+EAV K + + E+ +E


3C92_(A)

185

PEKEAVTLGIKALKSSLEEGEE

206

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3C92 (Chain A)
Thermoplasma Acidophilum 20s Proteasome With A Closed Gate
  • PDB_Info
  • Homolog SourceThermoplasma acidophilum
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05