Take our Survey

Alignment of YOR142W-B and PDB 3OYE (chain B) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein YOR142W-B. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene YOR142W-B and PDB protein 3OYE (chain B)Jump to
Structure
Alignment Details
YOR142W-B length = 1756 aaAlignment Length = 201 aa (11.4%)P-value = 0.000149%Identity = 26%Similar = 16
Alignment Position

Sequence Alignment

YOR142W-B

636

QCPDCLIGKSTKHRHIKGSRLKYQNSYEPFQYLHTDIFGPVHNLPKSAPSYFISFTDETT

695






+C CLI ++ G L+ +PF D GP+ P Y + D T


3OYE_(B)

98

RCQQCLITNASNKA--SGPILRPDRPQKPFDKFFIDYIGPLP--PSQGYLYVLVVVDGMT

153

YOR142W-B

696

KFRWVYPLHDRREDSI---LDVFTTILAFIKNQFQASVLVIQMDRGSEYTNRTLHKFLEK

752






F W+YP + L+V T+I A K VI D+G+ +T+ T ++ ++


3OYE_(B)

154

GFTWLYPTKAPSTSATVKSLNVLTSI-AIPK--------VIHSDQGAAFTSSTFAEWAKE

204

YOR142W-B

753

NGITPCYTTTADSRAHGVAERLNRTLLDDCRTQLQCSGLPNHLWFSAIEFSTIVRNSLAS

812






GI ++T ++ G ER N + T+L G P W+ + + N+ S


3OYE_(B)

205

RGIHLEFSTPYHPQSSGKVERKNSDI-KRLLTKLLV-GRPTK-WYDLLPVVQLALNNTYS

261

YOR142W-B

813

PKSKKSARQHAGLAGLDISTLLPF

836






P K + H L G+D +T PF


3OYE_(B)

262

PVLKYTP--HQLLFGIDSNT--PF

281

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3OYE (Chain B)
Crystal Structure Of The Prototype Foamy Virus (Pfv) Intasome In Complex With Magnesium And The Insti Compound2
  • PDB_Info
  • Homolog SourceHuman spumaretrovirus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05