Take our Survey

Alignment of RPB11/YOL005C and PDB 4C3J (chain K) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein RPB11/YOL005C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene RPB11/YOL005C and PDB protein 4C3J (chain K)Jump to
Structure
Alignment Details
RPB11 length = 121 aaAlignment Length = 105 aa (86.8%)P-value = 2.4e-06%Identity = 30%Similar = 19
Alignment Position

Sequence Alignment

RPB11

4

PDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKV

63






PDR ++ LL + S + T A +V +EDHTLGN +R ++ + V F Y +


4C3J_(K)

42

PDREKIKLLTQATS----EDGTSASFQIV----EEDHTLGNALRYVIMKNPDVEFCGYSI

93

RPB11

64

EHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETE

108






HP +RIQT DAL+ +++ +++ F TE


4C3J_(K)

94

PHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKF-TE

137

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein4C3J (Chain K)
Structure Of 14-subunit Rna Polymerase I At 3.35 A Resolution, Crystal Form C2-90
  • PDB_Info
  • Homolog SourceSaccharomyces cerevisiae
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05