Take our Survey

Alignment of RPB11/YOL005C and PDB 3H0G (chain K) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein RPB11/YOL005C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene RPB11/YOL005C and PDB protein 3H0G (chain K)Jump to
Structure
Alignment Details
RPB11 length = 121 aaAlignment Length = 117 aa (96.7%)P-value = 3.8e-24%Identity = 46%Similar = 18
Alignment Position

Sequence Alignment

RPB11

1

MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA

60






MN P+R+EL L G K+ + D+K+PNA V+T EKEDHTL N++ +LL+D +VLFA


3H0G_(K)

1

MNQPERYELIEL-MGLPKVTYELDSKSPNAAVVTLEKEDHTLANMLANQLLSDERVLFAG

59

RPB11

61

YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAAD

117






YKV HP F LR+QT E PK + +A S+I L +K NF EW L+ ++ +


3H0G_(K)

60

YKVPHPLNHNFILRVQTVEDCSPKQVIVDAAKSLITHLEEIKVNFMREWELKMISVE

116

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3H0G (Chain K)
Rna Polymerase Ii From Schizosaccharomyces Pombe
  • PDB_Info
  • Homolog SourceSchizosaccharomyces pombe 972h-
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05