Alignment of RPB11/YOL005C and PDB 3CQZ (chain K) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein RPB11/YOL005C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene RPB11/YOL005C and PDB protein 3CQZ (chain K)Jump to
Structure
Alignment Details
RPB11 length = 121 aaAlignment Length = 120 aa (99.2%)P-value = 6.4e-61%Identity = 100%Similar = 0
Alignment Position

Sequence Alignment

RPB11

1

MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA

60






MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA


3CQZ_(K)

1

MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA

60

RPB11

61

YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF

120






YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF


3CQZ_(K)

61

YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF

120

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3CQZ (Chain K)
Crystal Structure Of 10 Subunit Rna Polymerase Ii In Complex With The Inhibitor Alpha-Amanitin
  • PDB_Info
  • Homolog SourceSaccharomyces cerevisiae
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05