Take our Survey

Alignment of RPB11/YOL005C and PDB 2PA8 (chain L) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein RPB11/YOL005C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene RPB11/YOL005C and PDB protein 2PA8 (chain L)Jump to
Structure
Alignment Details
RPB11 length = 121 aaAlignment Length = 66 aa (54.5%)P-value = 8.9e-07%Identity = 41%Similar = 11
Alignment Position

Sequence Alignment

RPB11

29

NAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALK

88






N + + E EDHTLGNLI L V FA+Y HP + ++I T PKDAL


2PA8_(L)

11

NYLELEIEGEDHTLGNLIAGTLRRISGVSFASYYQPHPLSDKIIVKILTDGSITPKDALL

70

RPB11

89

NACNSI

94






A +I


2PA8_(L)

71

KAIENI

76

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein2PA8 (Chain L)
X-Ray Crystal Structure Of The DL SUBCOMPLEX OF THE SULFOLOBUS Solfataricus Rna Polymerase
  • PDB_Info
  • Homolog SourceSulfolobus solfataricus P2
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05