Alignment of RPB11/YOL005C and PDB 2JA7 (chain W) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein RPB11/YOL005C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene RPB11/YOL005C and PDB protein 2JA7 (chain W)Jump to
Structure
Alignment Details
RPB11 length = 121 aaAlignment Length = 120 aa (99.2%)P-value = 6.4e-61%Identity = 100%Similar = 0
Alignment Position

Sequence Alignment

RPB11

1

MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA

60






MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA


2JA7_(W)

1

MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAA

60

RPB11

61

YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF

120






YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF


2JA7_(W)

61

YKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF

120

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein2JA7 (Chain W)
Cpd Lesion Containing Rna Polymerase Ii Elongation Complex C
  • PDB_Info
  • Homolog SourceSaccharomyces cerevisiae
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05