Take our Survey

Alignment of RPB11/YOL005C and PDB 1XPP (chain C) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein RPB11/YOL005C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene RPB11/YOL005C and PDB protein 1XPP (chain C)Jump to
Structure
Alignment Details
RPB11 length = 121 aaAlignment Length = 94 aa (77.7%)P-value = 9.2e-05%Identity = 27%Similar = 22
Alignment Position

Sequence Alignment

RPB11

16

ESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRI

75






ES L++ +K N++ + D+TL + E+L D +V A Y ++HP ++ +


1XPP_(C)

10

ESSLRVI--SKEKNSITVEMINYDNTLLRTLVEEILKDDQVDEARYYIKHPVIDNPQIYV

67

RPB11

76

QTTEGYDPKDALKNACNSIINKLGALKTNFETEW

109






+ G P+ A+K A + L T F+ E+


1XPP_(C)

68

RVKSG-KPQSAIKRAVRKLSKLYEDLGTQFQKEF

100

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein1XPP (Chain C)
Crystal Structure Of Ta1416,Dna-Directed Rna Polymerase Subunit L, From Thermoplasma Acidophilum
  • PDB_Info
  • Homolog SourceThermoplasma acidophilum
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05