Alignment of RAD50/YNL250W and PDB 1XFV (chain E) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein RAD50/YNL250W. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene RAD50/YNL250W and PDB protein 1XFV (chain E)Jump to
Structure
Alignment Details
RAD50 length = 1313 aaAlignment Length = 281 aa (21.4%)P-value = 0.004800%Identity = 24%Similar = 21
Alignment Position

Sequence Alignment

RAD50

471

NHELENLKTYKEKLQSWESENIIPKLNQKIEEKNNEMIILENQIEKFQDRIMKTNQQA-D

529






NH+ E KT KEK + +S N + K E NE + ++I++ QD + K + +


1XFV_(E)

23

NHKTEKNKTEKEKFK--DSINNLVKT-----EFTNETL---DKIQQTQDLLKKIPKDVLE

72

RAD50

530

LYAKLG--LIKKSIN-TKLDELQKITEKLQNDSRIR-QVFPLTQEFQRADLEMDFQKLFI

585






+Y++LG + I+ + ELQ ++E+ +N R + P F + + + KL I


1XFV_(E)

73

IYSELGGEIYFTDIDLVEHKELQDLSEEEKNSMNSRGEKVPFASRFV-FEKKRETPKLII

131

RAD50

586

NMQKNIAINNKKMHELDRRYTNALYNLNTIEKDLQDNQKSKEKVIQLLSENLPEDCTIDE

645






N+ K+ AIN+++ E+ + +L+ I KD + + + L ++ D +


1XFV_(E)

132

NI-KDYAINSEQSKEVYYEIGKGI-SLDIISKDKSLDPEFLNLIKSLSDDSDSSDLLFSQ

189

RAD50

646

-YNDVLE--ETELSYKTALENLK--MHQTTLEFN-------RKALEIAERDSCCYLCSRK

693






+ + LE + ENL H +L F+ R LE+ D Y+ K


1XFV_(E)

190

KFKEKLELNNKSIDINFIKENLTEFQHAFSLAFSYYFAPDHRTVLELYAPDMFEYM--NK

247

RAD50

694

FENESFKSKLLQELKTKTDANFEKTLKDTVQNEKEYLHSLRLLEKHIITLNSINEKID

751






E F+ K+ + LK + EK D ++ EK L + L+ +H I +++


1XFV_(E)

248

LEKGGFE-KISESLKKE---GVEKDRIDVLKGEKA-LKASGLVPEHADAFKKIARELN

300

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein1XFV (Chain E)
Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And 3' Deoxy-Atp
  • PDB_Info
  • Homolog SourceBacillus anthracis
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-12-05