Alignment of LCB1/YMR296C and PDB 2JGT (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein LCB1/YMR296C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene LCB1/YMR296C and PDB protein 2JGT (chain A)Jump to
Structure
Alignment Details
LCB1 length = 559 aaAlignment Length = 345 aa (61.7%)P-value = 1.1e-24%Identity = 25%Similar = 21
Alignment Position

Sequence Alignment

LCB1

77

QKKSLQAQKPNLSPQ-----EIDALIEDWEPEPLVDPSATDEQSWRVAKTPVTMEMPIQN

131






Q +L A P+++P+ + D LI E + L+D T+ + + + E I+


2JGT_(A)

7

QPHALPADAPDIAPERDLLSKFDGLIA--ERQKLLDSGVTEPFAIVMEQVKSPTEAVIRG

64

LCB1

132

HITITRNNLQEKYTNVFNLASNNFLQLSATEPVKEVVKTTIKNYGVGACGPAGFYGNQDV

191






TI L + N++ ++ V K ++ +G G G G


2JGT_(A)

65

KDTIL-------------LGTYNYMGMTFDPDVIAAGKEALEKFGSGTNGSRMLNGTFHD

111

LCB1

192

HYTLEYDLAQFFGTQGSVLYGQDFCAAPSVLPAFTKRGDVIVADDQVSLPVQNALQLSRS

251






H +E L F+GT G++++ + A ++ +G+ ++ D + + Q +


2JGT_(A)

112

HMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSHASIYDGCQQGNA

171

LCB1

252

TVYYFNHNDMNSLECLLNELTEQEKLEKLPAIPRKFIVTEGIFHNSGDLAPLPELTKLKN

311






+ F HN + L+ ++L +LP P K +V EG++ GD+APL E+ +


2JGT_(A)

172

EIVRFRHNSVEDLD---------KRLGRLPKEPAKLVVLEGVYSMLGDIAPLKEMVAVAK

222

LCB1

312

KYKFRLFVDETFSIGVLGATGRGLSEHFNMDRATAIDITVGSMATALGSTGGFVLGDSVM

371






K+ + VDE S+G G GRG+ E ++ ID VG+ + ++G+ GGFV+ +


2JGT_(A)

223

KHGAMVLVDEAHSMGFFGPNGRGVYEAQGLEGQ--IDFVVGTFSKSVGTVGGFVVSNHPK

280

LCB1

372

CLHQRIGSNAYCFSACLPAYTV-TSVSKVLKLMDSNNDAVQTLQKLSKSLH

421






R+ Y F+A LP V T+ + + KLM ++ + L +++LH


2JGT_(A)

281

FEAVRLACRPYIFTASLPPSVVATATTSIRKLMTAHEKR-ERLWSNARALH

330

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein2JGT (Chain A)
Low Resolution Structure Of Spt
  • PDB_Info
  • Homolog SourceSphingomonas paucimobilis
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-12-05