Alignment of ALD2/YMR170C and PDB 3RHQ (chain D) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein ALD2/YMR170C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene ALD2/YMR170C and PDB protein 3RHQ (chain D)Jump to
Structure
Alignment Details
ALD2 length = 507 aaAlignment Length = 485 aa (95.7%)P-value = 1.3e-100%Identity = 43%Similar = 18
Alignment Position

Sequence Alignment

ALD2

14

KISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQAANEKDVDKAVKAARAAFDN

73






K++L+ P LFI EF + KT T+NP G I A DVDKAV AA+ AF+N


3RHQ_(D)

30

KLTLQMPYQLFIGGEFVDAEGSKTYNTINPTDGSVICQVSLAQVSDVDKAVAAAKEAFEN

89

ALD2

74

-VWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPYHSNAKGDLAQILQLTRYFA

132






+W K ++ RG L L ++E+ Q+ LA +E LDAG Y K + +Q RYFA


3RHQ_(D)

90

GLWGKINARDRGRLLYRLADVMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFA

149

ALD2

133

GSADKFDKGATIPLTF---NK-FAYTLKVPFGVVAQIVPWNYPLAMACWKLQGALAAGNT

188






G DK +GATIP+ N+ T K P GV ++PWNYPL M WK LAAGNT


3RHQ_(D)

150

GWCDKI-QGATIPINQARPNRNLTLTKKEPVGVCGIVIPWNYPLMMLSWKTAACLAAGNT

208

ALD2

189

VIIKPAENTSLSLLYFATLIKKAGFPPGVVNIVPGYGSLVGQALASHMDIDKISFTGSTK

248






V+IKPA+ T L+ L FA L KAG P GVVNI+PG GSLVGQ L+ H D+ KI FTGST+


3RHQ_(D)

209

VVIKPAQVTPLTALKFAELTLKAGIPKGVVNILPGSGSLVGQRLSDHPDVRKIGFTGSTE

268

ALD2

249

VGGFVLEASGQSNLKDVTLECGGKSPALVFEDADLDKAIDWIAAGIFYNSGQNCTANSRV

308






VG ++++ SN+K V+LE GGKSP ++F D DL+KA+ + +F+N G+N A R+


3RHQ_(D)

269

VGKHIMKSCALSNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKGENAIAAGRL

328

ALD2

309

YVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKREE

368






+V+ SI+++FV+K E +K G +P + GP ++ Y +RG +E


3RHQ_(D)

329

FVEESIHNQFVQKVVEEVEKM--KIG--NPLERDTNHGPQNHEAHLRKLVEYCQRGVKEG

384

ALD2

369

KLDMFQTSEFPIGGAKGYFIPPTIFTDVPQTSKLLQDEIFGPVVVVSKFTNYD-DA-LKL

426






+ ++ P G+F PT+FTDV + ++E FGP++++S+F + D DA L


3RHQ_(D)

385

ATLVCGGNQVP---RPGFFFQPTVFTDVEDHMYIAKEESFGPIMIISRFADGDVDAVLSR

441

ALD2

427

ANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINSSNDEDVTVPFGGFKMSGIGRELGQ

486






AN T +GLAS VFT+D+ KA + ++AGTV+IN+ N DV PFGGFK SG G++LG+


3RHQ_(D)

442

ANATEFGLASGVFTRDINKALYVSDKLQAGTVFINTYNKTDVAAPFGGFKQSGFGKDLGE

501

ALD2

487

SGVDTYLQTKAV

498






+ ++ YL+ K V


3RHQ_(D)

502

AALNEYLRIKTV

513

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3RHQ (Chain D)
Crystal Structure Of The C707a Mutant Of C-Terminal Domain Of 10'formyltetrahydrofolate Dehydrogenase In Complex With Nadp
  • PDB_Info
  • Homolog SourceRattus norvegicus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-12-05