Alignment of ALD2/YMR170C and PDB 2EJL (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein ALD2/YMR170C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene ALD2/YMR170C and PDB protein 2EJL (chain A)Jump to
Structure
Alignment Details
ALD2 length = 507 aaAlignment Length = 476 aa (93.9%)P-value = 3.8e-58%Identity = 33%Similar = 19
Alignment Position

Sequence Alignment

ALD2

23

LFINNEFCPSSDGKTIETVNP-ATGEPITSFQAANEKDVDKAVKAARAAFDNVWSKTSSE

81






L+I E+ + + + ++NP A E + + A + + + A++AA AF W E


2EJL_(A)

40

LYIGGEWVDTKE--RMVSLNPSAPSEVVGTTAKAGKAEAEAALEAAWKAF-KTWKDWPQE

96

ALD2

82

QRGIYLSNLLKLIEEEQDTLAALETLDAGKPYHSNAKGDLAQILQLTRYFAGSADKFDKG

141






R L L+ + L A + GK + A D+A+ + Y+A +A ++


2EJL_(A)

97

DRSRLLLKAAALMRRRKRELEATLVYEVGKNW-VEASADVAEAIDFIEYYARAALRYRYP

155

ALD2

142

ATIPLTF-NKFAYTLKVPFGVVAQIVPWNYPLAMACWKLQGALAAGNTVIIKPAENTSLS

200






A + + + + VP G I PWN+P+A+ + G +A GNTVI KPAE+ +


2EJL_(A)

156

AVEVVPYPGEDNESFYVPLGAGVVIAPWNFPVAIFTGMIVGPVAVGNTVIAKPAEDAVVV

215

ALD2

201

LLYFATLIKKAGFPPGVVNIVPGYGSLVGQALASHMDIDKISFTGSTKVGGFVLEASG--

258






+ +AGFPPGVVN +PG G VG L H I I+FTGS +VG + EA+G


2EJL_(A)

216

GAKVFEIFHEAGFPPGVVNFLPGVGEEVGAYLVEHPRIRFINFTGSLEVGLKIYEAAGRL

275

ALD2

259

---QSNLKDVTLECGGKSPALVFEDADLDKAIDWIAAGIFYNSGQNCTANSRVYVQSSIY

315






Q+ K +E GGK +V E AD D A + + + GQ +A SR+ + Y


2EJL_(A)

276

APGQTWFKRAYVETGGKDAIIVDETADFDLAAEGVVVSAYGFQGQKXSAASRLILTQGAY

335

ALD2

316

DKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKREEKLDMFQT

375






+ +E+ + A++ P +E +GPV+S+ Q ++ SYIE GK E +L +


2EJL_(A)

336

EPVLERVLKRAERL-----SVGPAEENPDLGPVVSAEQERKVLSYIEIGKNEGQLVLGGK

390

ALD2

376

SEFPIGGAKGYFIPPTIFTDVPQTSKLLQDEIFGPVVVVSKFTNYDDALKLANDTCYGLA

435






+ G +GYFI PT+FT+VP +++ Q+EIFGPV+ V + ++ +AL++ANDT YGL


2EJL_(A)

391

R---LEG-EGYFIAPTVFTEVPPKARIAQEEIFGPVLSVIRVKDFAEALEVANDTPYGLT

446

ALD2

436

SAVFTKDVKKAHM-FAR-DIKAGTVWINSS-NDEDVTV-PFGGFKMSGIGRELGQSG-VD

490






V+++ K+ H+ +AR + G ++ N V V PFGGFK+SG + G +


2EJL_(A)

447

GGVYSR--KREHLEWARREFHVGNLYFNRKITGALVGVQPFGGFKLSGTNAKTGALDYLR

504

ALD2

491

TYLQTKAV

498






+L+ KAV


2EJL_(A)

505

LFLEMKAV

512

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein2EJL (Chain A)
Crystal Analysis Of Delta1-pyrroline-5-carboxylate Dehydrogenase From Thermus Thermophilus With Bound L-serine
  • PDB_Info
  • Homolog SourceThermus thermophilus HB8
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-12-05