Alignment of YLR410W-B and PDB 2X6S (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein YLR410W-B. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene YLR410W-B and PDB protein 2X6S (chain A)Jump to
Structure
Alignment Details
YLR410W-B length = 1771 aaAlignment Length = 184 aa (10.4%)P-value = 0.001300%Identity = 27%Similar = 12
Alignment Position

Sequence Alignment

YLR410W-B

649

GSRLKYQESYEPFQYLHTDIFGPVHHLPKSAPSYFISFTDEKTRFQWVYPLHDRREESI-

707






G L+ +PF D GP+ P Y + D T F W+YP +


2X6S_(A)

1

GPILRPDRPQKPFDKFFMDYIGPLP--PSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATV

58

YLR410W-B

708

--LNVFTSILAFIKNQFNARVLVIQMDRGSEYTNKTLHKFFTNRGITACYTTTADSRAHG

765






LNV TSI A VI D+G+ +T+ T ++ RGI ++T ++


2X6S_(A)

59

KSLNVLTSI---------AIPRVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSGS

109

YLR410W-B

766

VAERLNRTLLNDCRTLLHCSGLPNHLWFSAVEFSTIIRNSLVSPKNDKSARQHAGLAGLD

825






ER N + LL G P W+ + + N+ SP + H L G+D


2X6S_(A)

110

KVERKNSDMKRLLTKLL--VGRPTK-WYDLLPVVQLAMNNTYSPVLKYTP--HQLLFGID

164

YLR410W-B

826

ITTILPF

832






T PF


2X6S_(A)

165

SNT--PF

169

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein2X6S (Chain A)
Human Foamy Virus Integrase - Catalytic Core. Magnesium- Bound Structure.
  • PDB_Info
  • Homolog SourceHuman spumaretrovirus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-12-05