Alignment of ASP3-1/YLR155C and PDB 4PGA (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein ASP3-1/YLR155C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene ASP3-1/YLR155C and PDB protein 4PGA (chain A)Jump to
Structure
Alignment Details
ASP3-1 length = 363 aaAlignment Length = 330 aa (90.9%)P-value = 8.7e-45%Identity = 35%Similar = 19
Alignment Position

Sequence Alignment

ASP3-1

27

EKNSSLPSIKIFGTGGTIASKGSTSATTAGYSVG-LTVNDLIEAVPSLAEKANLDYLQVS

85






E L ++ I TGGTIA G+++A +A Y + V+ LI VP LA+ AN+ QV


4PGA_(A)

4

ENQQKLANVVILATGGTIAGAGASAANSATYQAAKVGVDKLIAGVPELADLANVRGEQVM

63

ASP3-1

86

NVGSNSLNYTHLIPLYHGISEALASDDYAGAVVTHGTDTMEETAFFLDLTINSEKPVCIA

145






+ S S+ L+ L ++E S+D G V+THGTDT+EETA+FL+L ++KP+ +


4PGA_(A)

64

QIASESITNDDLLKLGKRVAELADSNDVDGIVITHGTDTLEETAYFLNLVQKTDKPIVVV

123

ASP3-1

146

GAMRPATATSADGPMNLYQAVSIAASEKSLGRGTMITLNDRIASGFWTTKMNANSLDTFR

205






G+MRP TA SADG +NLY AV++A+++ S G+G ++T+ND I SG +K + F+


4PGA_(A)

124

GSMRPGTAMSADGMLNLYNAVAVASNKDSRGKGVLVTMNDEIQSGRDVSKSINIKTEAFK

183

ASP3-1

206

ADEQGYLGYFSNDDVEFYYPPVKPNGWQF-FDISNLTDPSEIPEVIILYSYQGLNPELIV

264






+ G LG ++ P K + FDI + S +P+V I YSY + +


4PGA_(A)

184

S-AWGPLGMVVEGKSYWFRLPAKRHTVNSEFDIKQI---SSLPQVDIAYSYGNVT-DTAY

238

ASP3-1

265

KAVKDLGAKGIVLAGSGAGSWTATGSIVNEQLYEEYGIPIVHSRRTADG------TVPPD

318






KA+ GAK ++ AG+G GS ++ +QL + G I+ S G PD


4PGA_(A)

239

KALAQNGAKALIHAGTGNGSVSSRVVPALQQLRKN-GTQIIRSSHVNQGGFVLRNAEQPD

297

ASP3-1

319

DAPEYAIGSGYLNPQKSRILLQLCLYSGYGMDQIRSVF

356






D ++ + LNP+K+RIL + + +++ +F


4PGA_(A)

298

DKNDWVVAHD-LNPEKARILAMVAMTKTQDSKELQRIF

334

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein4PGA (Chain A)
Glutaminase-asparaginase From Pseudomonas 7a
  • PDB_Info
  • Homolog SourcePseudomonas sp. 7A
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-12-05