Alignment of ASP3-1/YLR155C and PDB 3PGA (chain 2) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein ASP3-1/YLR155C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene ASP3-1/YLR155C and PDB protein 3PGA (chain 2)Jump to
Structure
Alignment Details
ASP3-1 length = 363 aaAlignment Length = 325 aa (89.5%)P-value = 6.1e-47%Identity = 36%Similar = 20
Alignment Position

Sequence Alignment

ASP3-1

32

LPSIKIFGTGGTIASKGSTSATTAGYSVG-LTVNDLIEAVPSLAEKANLDYLQVSNVGSN

90






L ++ I TGGTIA G+++A +A Y + V+ LI VP LA+ AN+ QV + S


3PGA_(2)

9

LANVVILATGGTIAGAGASAANSATYQAAKVGVDKLIAGVPELADLANVRGEQVMQIASE

68

ASP3-1

91

SLNYTHLIPLYHGISEALASDDYAGAVVTHGTDTMEETAFFLDLTINSEKPVCIAGAMRP

150






S+ L+ L ++E S+D G V+THGTDT+EETA+FLDLT+N++KP+ + G+MRP


3PGA_(2)

69

SITNDDLLKLGKRVAELADSNDVDGIVITHGTDTLEETAYFLDLTLNTDKPIVVVGSMRP

128

ASP3-1

151

ATATSADGPMNLYQAVSIAASEKSLGRGTMITLNDRIASGFWTTKMNANSLDTFRADEQG

210






TA SADG +NLY AV++A+++ S G+G ++T+ND I SG +K + F++ G


3PGA_(2)

129

GTAMSADGMLNLYNAVAVASNKDSRGKGVLVTMNDEIQSGRDVSKSINIKTEAFKS-AWG

187

ASP3-1

211

YLGYFSNDDVEFYYPPVKPNGWQF-FDISNLTDPSEIPEVIILYSYQGLNPELIVKAVKD

269






LG ++ P K + FDI + S +P+V I YSY + + KA+


3PGA_(2)

188

PLGMVVEGKSYWFRLPAKRHTVNSEFDIKQI---SSLPQVDIAYSYGNVT-DTAYKALAQ

243

ASP3-1

270

LGAKGIVLAGSGAGSWTATGSIVNEQLYEEYGIPIVHSRRTADG------TVPPDDAPEY

323






GAK ++ AG+G GS ++ + + L + G I+ S G PDD ++


3PGA_(2)

244

NGAKALIHAGTGNGSVSSRLTPALQTL-RKTGTQIIRSSHVNQGGFVLRNAEQPDDKNDW

302

ASP3-1

324

AIGSGYLNPQKSRILLQLCLYSGYGMDQIRSVF

356






+ LNP+K+RIL++L + +++ +F


3PGA_(2)

303

VVAHD-LNPEKARILVELAMVKTQDSKELQRIF

334

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3PGA (Chain 2)
Structural Characterization Of Pseudomonas 7a Glutaminase- Asparaginase
  • PDB_Info
  • Homolog SourcePseudomonas sp. 7A
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05