Alignment of ASP3-1/YLR155C and PDB 3NXK (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein ASP3-1/YLR155C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene ASP3-1/YLR155C and PDB protein 3NXK (chain A)Jump to
Structure
Alignment Details
ASP3-1 length = 363 aaAlignment Length = 322 aa (88.7%)P-value = 8.0e-51%Identity = 39%Similar = 20
Alignment Position

Sequence Alignment

ASP3-1

35

IKIFGTGGTIASKGSTSATTAGYSVG-LTVNDLIEAVPSLAEKANLDYLQVSNVGSNSLN

93






I I GTGGTIA ++ T GY+ G + ++ LI+AVP + + A++ + Q++N+ S++


3NXK_(A)

11

IAILGTGGTIAGFIDSTIATTGYAAGAIDIDVLIKAVPQIRDLADISWEQIANIDSSNXC

70

ASP3-1

94

YTHLIPLYHGISEALASDDYAGAVVTHGTDTMEETAFFLDLTINSEKPVCIAGAMRPATA

153






+ L I++ A + G V+THGTDT EETA+FL+LTI S+KPV + GA RP+TA


3NXK_(A)

71

DEIWLRLAKKIAKLFA-EGIDGVVITHGTDTXEETAYFLNLTIKSDKPVVLVGAXRPSTA

129

ASP3-1

154

TSADGPMNLYQAVSIAASEKSLGRGTMITLNDRIASGFWTTKMNANSLDTFRADEQGYLG

213






SADGP NLY AV++ ++++ +G + +ND+I S K ++ ++D F + + G LG


3NXK_(A)

130

ISADGPKNLYNAVALVVNKEAKNKGVXVAINDKILSARGVVKTHSLNVDAFSSPDFGDLG

189

ASP3-1

214

YFSNDDVEFYYPPVKPNGWQF-FDISNLTDPSEIPEVIILYSYQGLNPELIVKAVKDLGA

272






Y + V FY +K + FD+S LT +P+V ILYSY + KA+ + G


3NXK_(A)

190

YIVDGKVFFYNNVIKAHTKNAPFDVSKLTS---LPKVDILYSYSNDGSGVAAKALFEHGT

246

ASP3-1

273

KGIVLAGSGAGSWTATGSIVNEQLYEEYGIPIVHSRRTADGTVPPDDAPEYA--IGSGYL

330






KGIV+AGSGAGS V ++L ++ G+ +V S R G V D+ E I + L


3NXK_(A)

247

KGIVVAGSGAGSIHKNQKDVLKELLKK-GLKVVVSSRVVAGCVAVSDSDEKLGFISAEDL

305

ASP3-1

331

NPQKSRILLQLCLYSGYGMDQIRSVF

356






NPQK+R+LL L L +I+ F


3NXK_(A)

306

NPQKARVLLXLALTKTSDPKKIQEYF

331

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3NXK (Chain A)
Crystal Structure Of Probable Cytoplasmic L-Asparaginase From Campylobacter Jejuni
  • PDB_Info
  • Homolog SourceCampylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-12-05