Alignment of ASP3-1/YLR155C and PDB 3NTX (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein ASP3-1/YLR155C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene ASP3-1/YLR155C and PDB protein 3NTX (chain A)Jump to
Structure
Alignment Details
ASP3-1 length = 363 aaAlignment Length = 217 aa (59.8%)P-value = 9.5e-08%Identity = 26%Similar = 17
Alignment Position

Sequence Alignment

ASP3-1

111

DDYAGAVVTHGTDTMEETAFFLDLTI-NSEKPVCIAGAMRPATATSADGPMNLYQAVSIA

169






D Y G V+ HGTDT TA L + N KPV I G+ P +DG NL A+ +A


3NTX_(A)

83

DLYDGFVILHGTDTXAFTASALSFXLENLAKPVIITGSQIPLAELRSDGQTNLLNALYLA

142

ASP3-1

170

ASEKSLGRGTMITLNDRIASGFWTTKMNANSLDTFRADEQGYLGYFSNDDVEFYYPPVKP

229






A+ + N+++ G TTK +A+ DTF + L + + V P


3NTX_(A)

143

ANHPV--NEVSLFFNNQLFRGNRTTKAHADGFDTFASPNLSVL-LEAGIHIRRQSSVVSP

199

ASP3-1

230

NGWQFFDISNLTDPSEIPEVIILYSYQGLNPELIVKAVKDLGAKGIVLAGSGAGSWTATG

289






+ +T P I V I Y G++ ++ + K ++L G G+


3NTX_(A)

200

TSNGPLIVHRIT-PQPIGVVTI---YPGISGAVVRNFLLQ-PVKALILRSYGVGNAPQKA

254

ASP3-1

290

SIVNE-QLYEEYGIPIVHSRRTADGTVPPDDAPEYAIGS

327






+++E + + GI +V+ + G+V + YA G+


3NTX_(A)

255

ELLDELKNASDRGIVVVNLTQCISGSV---NXGGYATGN

290

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein3NTX (Chain A)
Crystal Structure Of L-Asparaginase I From Yersinia Pestis
  • PDB_Info
  • Homolog SourceYersinia pestis CO92
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05