Alignment of ASP3-1/YLR155C and PDB 2WT4 (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein ASP3-1/YLR155C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene ASP3-1/YLR155C and PDB protein 2WT4 (chain A)Jump to
Structure
Alignment Details
ASP3-1 length = 363 aaAlignment Length = 326 aa (89.8%)P-value = 3.8e-51%Identity = 38%Similar = 19
Alignment Position

Sequence Alignment

ASP3-1

31

SLPSIKIFGTGGTIASKGSTSATTAGYSVG-LTVNDLIEAVPSLAEKANLDYLQVSNVGS

89






+LP+I + TGGTIA G A+ Y G L V +L++A+PSL + A + QVSN+GS


2WT4_(A)

4

NLPTIALLATGGTIAGSG-VDASLGSYKSGELGVKELLKAIPSLNKIARIQGEQVSNIGS

62

ASP3-1

90

NSLNYTHLIPLYHGISEALASDDYAGAVVTHGTDTMEETAFFLDLTINSEKPVCIAGAMR

149






+N L E L G V+THGTDT+EE+A+FL+L ++S KPV + GAMR


2WT4_(A)

63

QDMNEEIWFKLAQRAQELLDDSRIQGVVITHGTDTLEESAYFLNLVLHSTKPVVLVGAMR

122

ASP3-1

150

PATATSADGPMNLYQAVSIAASEKSLGRGTMITLNDRIASGFWTTKMNANSLDTFRADEQ

209






A++ SADG +NLY+AVS+A +EKS +G ++ ++D I S K + + TF+A


2WT4_(A)

123

NASSLSADGALNLYEAVSVAVNEKSANKGVLVVMDDTIFSVREVVKTHTTHVSTFKALNS

182

ASP3-1

210

GYLGYFSNDDVEFYYPPVKPNGWQF-FDISNLTDPSEIPEVIILYSYQGLNPELIVKAVK

268






G +G +Y P++ + + F +S L P +P+V I+Y++ G+ P+L +A


2WT4_(A)

183

GAIGSVYYGKTRYYMQPLRKHTTESEFSLSQLKTP--LPKVDIIYTHAGMTPDLF-QASL

239

ASP3-1

269

DLGAKGIVLAGSGAGSWTATGSIVNEQLYEEYGIPIVHSRRTADGTVPPDDAPEYAIG--

326






+ AKG+V+AG G G+ +A G + Q + G+ IV S R G V + + A G


2WT4_(A)

240

NSHAKGVVIAGVGNGNVSA-GFLKAMQEASQMGVVIVRSSRVGSGGVTSGEIDDKAYGFI

298

ASP3-1

327

-SGYLNPQKSRILLQLCLYSGYGMDQIRSVF

356






S LNPQK+R+LLQL L +I+ +F


2WT4_(A)

299

TSDNLNPQKARVLLQLALTKTNDKAKIQEMF

329

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein2WT4 (Chain A)
Room Temperature Crystal Structure Of Helicobacter Pylori L- Asparaginase At 1.8 A Resolution
  • PDB_Info
  • Homolog SourceHelicobacter pylori
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-12-05