Alignment of ASP3-1/YLR155C and PDB 2P2D (chain C) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein ASP3-1/YLR155C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene ASP3-1/YLR155C and PDB protein 2P2D (chain C)Jump to
Structure
Alignment Details
ASP3-1 length = 363 aaAlignment Length = 205 aa (56.5%)P-value = 5.1e-11%Identity = 29%Similar = 17
Alignment Position

Sequence Alignment

ASP3-1

111

DDYAGAVVTHGTDTMEETAFFLDLTI-NSEKPVCIAGAMRPATATSADGPMNLYQAVSIA

169






DDY G V+ HGTDTM TA L + N KPV + G+ P +DG +NL A+ +A


2P2D_(C)

100

DDYDGFVILHGTDTMAYTASALSFMLENLGKPVIVTGSQIPLAELRSDGQINLLNALYVA

159

ASP3-1

170

ASEKSLGRGTMITLNDRIASGFWTTKMNANSLDTFRADEQGYLGYFSNDDVEFYYPPVKP

229






A+ + T+ N+R+ G TTK +A+ D F + L + + P P


2P2D_(C)

160

ANYP-INEVTLF-FNNRLYRGNRTTKAHADGFDAFASPNLPPL-LEAGIHIRRLNTPPAP

216

ASP3-1

230

NGWQFFDISNLTDPSEIPEVIILYSYQGLNPELIVKAVKDLGAKGIVLAGSGAGSWTATG

289






+G + +T P I V I Y G++ +++ ++ K ++L G G+


2P2D_(C)

217

HGEGELIVHPIT-PQPIGVVTI---YPGISADVVRNFLRQ-PVKALILRSYGVGNAPQNK

271

ASP3-1

290

SIVNE-QLYEEYGIPIVHSRRTADGTV

315






+ + E Q + GI +V+ + G V


2P2D_(C)

272

AFLQELQEASDRGIVVVNLTQCMSGKV

298

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein2P2D (Chain C)
Crystal Structure And Allosteric Regulation Of The Cytoplasmic Escherichia Coli L-Asparaginase I
  • PDB_Info
  • Homolog SourceEscherichia coli
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05