Take our Survey

Alignment of ASP3-1/YLR155C and PDB 2OCD (chain D) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein ASP3-1/YLR155C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene ASP3-1/YLR155C and PDB protein 2OCD (chain D)Jump to
Structure
Alignment Details
ASP3-1 length = 363 aaAlignment Length = 212 aa (58.4%)P-value = 1.7e-05%Identity = 25%Similar = 19
Alignment Position

Sequence Alignment

ASP3-1

104

ISEALAS--DDYAGAVVTHGTDTMEETAFFLDLTI-NSEKPVCIAGAMRPATATSADGPM

160






I++ +A+ D Y G V+ HGTDT TA L N KPV + G+ P +DG


2OCD_(D)

71

IADDIAANYDKYDGFVILHGTDTXAYTASALSFXFENLGKPVIVTGSQIPLADLRSDGQA

130

ASP3-1

161

NLYQAVSIAASEKSLGRGTMITLNDRIASGFWTTKMNANSLDTFRADEQGYLGYFSNDDV

220






NL A+ +AA+ + T+ N+R+ G + K +A+ F + L + ++


2OCD_(D)

131

NLLNALHVAANYP-INEVTLF-FNNRLXRGNRSRKSHADGFSAFSSPNLPPL-LEAGINI

187

ASP3-1

221

EF---YYPPVKPNGWQFFDISNLTDPSEIPEVIILYSYQGLNPELIVKAVKDLGAKGIVL

277






E KP+G F ++ +T P I ++ Y G++ E+I + +L


2OCD_(D)

188

ELSTNVKVDEKPSGE--FKVNPIT-PQPIG---VITXYPGISHEVIRNTLLQ-PVNAXIL

240

ASP3-1

278

AGSGAGSWTATGSIVNE-QLYEEYGIPIVHSRRTADGTV

315






G G+ ++ + + E G+ +V+ + G V


2OCD_(D)

241

LTFGVGNAPQNPELLAQLKAASERGVIVVNLTQCLAGKV

279

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein2OCD (Chain D)
Crystal Structure Of L-Asparaginase I From Vibrio Cholerae O1 Biovar Eltor Str. N16961
  • PDB_Info
  • Homolog SourceVibrio cholerae
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05