Alignment of ASP3-1/YLR155C and PDB 2JK0 (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein ASP3-1/YLR155C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene ASP3-1/YLR155C and PDB protein 2JK0 (chain A)Jump to
Structure
Alignment Details
ASP3-1 length = 363 aaAlignment Length = 313 aa (86.2%)P-value = 6.8e-62%Identity = 45%Similar = 17
Alignment Position

Sequence Alignment

ASP3-1

31

SLPSIKIFGTGGTIASKGSTSATTAGYSVG-LTVNDLIEAVPSLAEKANLDYLQVSNVGS

89






+LP+I I TGGTIA + + T GY G L V LI+AVP L AN+ QV+++GS


2JK0_(A)

1

NLPNIVILATGGTIAGSAAANTQTTGYKAGALGVETLIQAVPELKTLANIKGEQVASIGS

60

ASP3-1

90

NSLNYTHLIPLYHGISEALASDDYAGAVVTHGTDTMEETAFFLDLTINSEKPVCIAGAMR

149






++ L+ L ++E LA D G V+THGTDT++E+ +FL+LT+ S+KPV AMR


2JK0_(A)

61

ENMTSDVLLTLSKRVNELLARSDVDGVVITHGTDTLDESPYFLNLTVKSDKPVVFVAAMR

120

ASP3-1

150

PATATSADGPMNLYQAVSIAASEKSLGRGTMITLNDRIASGFWTTKMNANSLDTFRADEQ

209






PATA SADGPMNLY AV +AA + S GRG ++ LNDRI S + +K NA++LDTF+A E+


2JK0_(A)

121

PATAISADGPMNLYGAVKVAADKNSRGRGVLVVLNDRIGSARFISKTNASTLDTFKAPEE

180

ASP3-1

210

GYLGYFSNDDVEFYYPPVKPNGWQ-FFDISNLTDPSEIPEVIILYSYQGLNPELIVKAVK

268






GYLG D + + K + + FD++N+ ++P V I+Y YQ +PE + A


2JK0_(A)

181

GYLGVIIGDKIYYQTRLDKVHTTRSVFDVTNV---DKLPAVDIIYGYQD-DPEYMYDASI

236

ASP3-1

269

DLGAKGIVLAGSGAGSWTATGSIVNEQLYEEYGIPIVHSRRTADGTVPPDDAPEYAIGSG

328






G KGIV AG GAGS + G + E GI +V S RT G VPPD A + + +


2JK0_(A)

237

KHGVKGIVYAGMGAGSVSKRGD-AGIRKAESKGIVVVRSSRTGSGIVPPD-AGQPGLVAD

294

ASP3-1

329

YLNPQKSRILLQLCL

343






L+P KSRILL L L


2JK0_(A)

295

SLSPAKSRILLMLAL

309

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein2JK0 (Chain A)
Structural And Functional Insights Into Erwinia Carotovora L-Asparaginase
  • PDB_Info
  • Homolog SourcePectobacterium carotovorum
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-01-23