Alignment of ASP3-1/YLR155C and PDB 2D6F (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein ASP3-1/YLR155C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene ASP3-1/YLR155C and PDB protein 2D6F (chain A)Jump to
Structure
Alignment Details
ASP3-1 length = 363 aaAlignment Length = 292 aa (80.4%)P-value = 3.9e-21%Identity = 28%Similar = 17
Alignment Position

Sequence Alignment

ASP3-1

24

IREEKNSSLPSIKIFGTGGTIASKGSTSATTAGYSVGLTVNDLIEAVPSLAEKANLDYLQ

83






+ ++ LP + I TGGT+AS T T +DL+ A P L + AN+


2D6F_(A)

82

VEAAEDPELPDVSIISTGGTVAS--IIDYRTGAVHPAFTADDLLRANPELLDIANIRGRA

139

ASP3-1

84

VSNVGSNSLNYTHLIPLYHGISEALASDDYAGAVVTHGTDTMEETAFFLDLTINSEKPVC

143






V N+ S ++ + + + + D G VV HGTDTM T+ L + + PV


2D6F_(A)

140

VFNILSENMKPEYWVETARAVYGEI-KDGADGVVVAHGTDTMHYTSAALSFMLRTPVPVV

198

ASP3-1

144

IAGAMRPATATSADGPMNLYQAVSIAASEKS----LGRGTMITLNDRIASGFWTTKMNAN

199






GA R + S+D +N+ +V A SE + TM L+ + G KM+ +


2D6F_(A)

199

FTGAQRSSDRPSSDASLNIQCSVRAATSEIAEVTVCMHATMDDLSCHLHRGVKVRKMHTS

258

ASP3-1

200

SLDTFRADEQGYLGYFSNDDVEFYYPPVKPNGWQFFDISNLTDPSEIPEVIILYSYQGLN

259






DTFR+ L + D ++ + G D L+D E V + SY G++


2D6F_(A)

259

RRDTFRSMNALPLAEVTPDGIKILEENYRKRG---SDELELSDRVE-ERVAFIKSYPGIS

314

ASP3-1

260

PELIVKAVKDLGAKGIVLAGSGAGSWTATG-SIVNEQLYEEYGIPIVHSRRTADGTV

315






P+ I+K D G +GIV+ G+G G T ++ E + G+P+ + + +G V


2D6F_(A)

315

PD-IIKWHLDEGYRGIVIEGTGLGHCPDTLIPVIGEA--HDMGVPVAMTSQCLNGRV

368

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein2D6F (Chain A)
Crystal Structure Of Glu-Trna(Gln) Amidotransferase In The Complex With Trna(Gln)
  • PDB_Info
  • Homolog SourceMethanothermobacter thermautotrophicus
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-12-05