Take our Survey

Alignment of ASP3-1/YLR155C and PDB 1ZQ1 (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein ASP3-1/YLR155C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene ASP3-1/YLR155C and PDB protein 1ZQ1 (chain A)Jump to
Structure
Alignment Details
ASP3-1 length = 363 aaAlignment Length = 289 aa (79.6%)P-value = 8.2e-21%Identity = 30%Similar = 16
Alignment Position

Sequence Alignment

ASP3-1

27

EKNSSLPSIKIFGTGGTIASKGSTSATTAGYSVGLTVNDLIEAVPSLAEKANLDYLQVSN

86






E LP + I GTGGTIAS+ T A Y T +L +A+P + E AN+ + N


1ZQ1_(A)

86

EGKPGLPEVTIIGTGGTIASRIDYE-TGAVYPA-FTAEELAKALPEIFEVANVKPKLLFN

143

ASP3-1

87

VGSNSLNYTHLIPLYHGISEALASDDYAGAVVTHGTDTMEETAFFLDLTI-NSEKPVCIA

145






+ S H + + H +++AL S DY G VV HGTDT TA L + N KPV +


1ZQ1_(A)

144

IFSEDXKPKHWVKIAHEVAKALNSGDY-GVVVAHGTDTXGYTAAALSFXLRNLGKPVVLV

202

ASP3-1

146

GAMRPATATSADGPMNLYQAVSIAASEKS----LGRGTMITLNDRIASGFWTTKMNANSL

201






GA R + S+D NL +V A SE + + G G K + +


1ZQ1_(A)

203

GAQRSSDRPSSDAAXNLICSVRXATSEVAEVXVVXHGETGDTYCLAHRGTKVRKXHTSRR

262

ASP3-1

202

DTFRA-DEQGYLGYFSNDDVEFYYPPVKPNGWQFFDISNLTDPSEIPEVIILYSYQGLNP

260






D FR+ ++ + N ++EF + + ++ D E +V ++ Y G++


1ZQ1_(A)

263

DAFRSINDVPIAKIWPNGEIEFLRKDYRKRSDEEVEVD---DKIE-EKVALVKVYPGISS

318

ASP3-1

261

ELIVKAVKDLGAKGIVLAGSGAGSWTATGSIVNEQLYEEYGIPIVHSRRTADGTV

315






E+I V D G KGIV+ G+G G T I + + E G+ + + + G V


1ZQ1_(A)

319

EIIDFLV-DKGYKGIVIEGTGLGH-TPNDIIPSIERAVEEGVAVCXTSQCIYGRV

371

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein1ZQ1 (Chain A)
Structure Of Gatde Trna-Dependent Amidotransferase From Pyrococcus Abyssi
  • PDB_Info
  • Homolog SourcePyrococcus abyssi
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05