Alignment of ASP3-1/YLR155C and PDB 1WSA (chain A) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein ASP3-1/YLR155C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene ASP3-1/YLR155C and PDB protein 1WSA (chain A)Jump to
Structure
Alignment Details
ASP3-1 length = 363 aaAlignment Length = 325 aa (89.5%)P-value = 2.8e-51%Identity = 37%Similar = 21
Alignment Position

Sequence Alignment

ASP3-1

33

PSIKIFGTGGTIASKGSTSATTAGYSVG-LTVNDLIEAVPSLAEKANLDYLQVSNVGSNS

91






P + I TGGTIA G +S ++ YS G +TV+ L+ AVP++ + A + Q+S++GS


1WSA_(A)

4

PQVTILATGGTIAGSGESSVKSS-YSAGAVTVDKLLAAVPAINDLATIKGEQISSIGSQE

62

ASP3-1

92

LNYTHLIPLYHGISEALASDDYAGAVVTHGTDTMEETAFFLDLTINSEKPVCIAGAMRPA

151






+ + L ++E LA + ++THGTDTMEETAFFL+LT+ S+KPV + GAMRP


1WSA_(A)

63

MTGKVWLKLAKRVNELLAQKETEAVIITHGTDTMEETAFFLNLTVKSQKPVVLVGAMRPG

122

ASP3-1

152

TATSADGPMNLYQAVSIAASEKSLGRGTMITLNDRIASGFWTTKMNANSLDTFRADEQGY

211






++ SADGPMNLY AV++A ++ S +G +I +ND I + TK+N +++ F + G


1WSA_(A)

123

SSMSADGPMNLYNAVNVAINKASTNKGVVIVMNDEIHAAREATKLNTTAVNAFASPNTGK

182

ASP3-1

212

LGYFSNDDVEFYYPPVKPNGWQF-FDISNLTDPSEIPEVIILYSYQGLNPELIVKAVKDL

270






+G VE++ V+P+ FDIS + E+P V ILY++ + +++V A


1WSA_(A)

183

IGTVYYGKVEYFTQSVRPHTLASEFDISKI---EELPRVDILYAHPD-DTDVLVNAALQA

238

ASP3-1

271

GAKGIVLAGSGAGS-WTATGSIVNEQLYEEYGIPIVHSRRTADGTVPP----DDAPEYAI

325






GAKGI+ AG G G+ + T + + + + G+ + S R G+ DD +


1WSA_(A)

239

GAKGIIHAGMGNGNPFPLTQNALEKAA--KSGVVVARSSRVGSGSTTQEAEVDDKKLGFV

296

ASP3-1

326

GSGYLNPQKSRILLQLCLYSGYGMDQIRSVFS

357






+ LNPQK+R+LL L L + I+ +FS


1WSA_(A)

297

ATESLNPQKARVLLMLALTKTSDREAIQKIFS

328

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein1WSA (Chain A)
Structure Of L-Asparaginase Ii Precursor
  • PDB_Info
  • Homolog SourceWolinella succinogenes
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05