Alignment of ASP3-1/YLR155C and PDB 1WNF (chain B) Help



This page compares a protein of known structure to the Saccharomyces cerevisiae protein ASP3-1/YLR155C. The analysis was performed by comparing yeast protein sequences against protein sequences in The RCSB Protein Databank (PDB) using WU-BLAST.

Alignment of yeast gene ASP3-1/YLR155C and PDB protein 1WNF (chain B)Jump to
Structure
Alignment Details
ASP3-1 length = 363 aaAlignment Length = 292 aa (80.4%)P-value = 1.2e-20%Identity = 28%Similar = 19
Alignment Position

Sequence Alignment

ASP3-1

35

IKIFGTGGTIAS-KGSTSATTAGYSVGLTVNDLIEAVPSLAEKANLDYLQVSNVGSNSLN

93






I I G GGTIAS KG GY L+V+ +++ + ++ +A ++ + NV S +


1WNF_(B)

3

ILILGMGGTIASVKGER-----GYESALSVSKILK-LAGISSEAKIEARDLMNVDSTLIQ

56

ASP3-1

94

YTHLIPLYHGISEALASDDYAGAVVTHGTDTMEETAFFLDLTI-NSEKPVCIAGAMRPAT

152






+ L I + + +Y G V+THGTDTM +A L + N P+ + G+M P T


1WNF_(B)

57

PSDWERLAKEIEKEVW--EYDGIVITHGTDTMAYSASMLSFMLRNPPIPIVLTGSMLPIT

114

ASP3-1

153

ATSADGPMNLYQAVSIAASEKSLG-RGTMITLNDRIASGFWTTKMNANSLDTFRADEQGY

211






++D P NL A+ LG RG I N ++ G +K+ + D F +


1WNF_(B)

115

EKNSDAPFNLRTALEFV----KLGIRGIYIAFNGKVMLGVRASKIRSMGFDAFESINYPN

170

ASP3-1

212

LGYFSNDDVEFYYPPVKPNGWQFFDISNLTDPSEIPEVIILYSYQGLNPELIVKAVKDLG

271






+ +D + + P F+ +D P+V+++ GL+ +++ +A++ LG


1WNF_(B)

171

VAEIKDDKLRILHIP------DFYGDEFFSDIKYEPKVLVIKLIPGLSGDIVREALR-LG

223

ASP3-1

272

AKGIVLAGSGAGSWTATGSIVNEQLYE-EYGIPIVHSRRTA-DGTVPPDDAPEYAIG

326






KGI+L G G G G+ + E + IP+V + + DG D Y +G


1WNF_(B)

224

YKGIILEGYGVGGIPYRGTDLFEVVSSISKRIPVVLTTQAIYDGV----DLQRYKVG

276

Homolog Structure
Information provided by The RCSB Protein Databank (PDB)Jump to
alignment
PDB protein1WNF (Chain B)
Crystal Structure Of Ph0066 From Pyrococcus Horikoshii
  • PDB_Info
  • Homolog SourcePyrococcus horikoshii
    External LinksSCOP
    MMDB
    CATH

    Last updated on 2014-06-05